KEGG   Streptococcus agalactiae 2603 (serotype V): SAG0053Help
Entry
SAG0053           CDS       T00091                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sag00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SAG0053 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAG0053 (adhE)
   00620 Pyruvate metabolism
    SAG0053 (adhE)
   00650 Butanoate metabolism
    SAG0053 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    SAG0053 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SAG0053 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAG0053 (adhE)
   00626 Naphthalene degradation
    SAG0053 (adhE)
Enzymes [BR:sag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAG0053 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SAG0053 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
69250..71892
Genome map
AA seq 880 aa AA seqDB search
MTEKTKAVETTDVALAIDTLVQNGLKALDEMRQLNQEQVDYIVAKASVAALDAHGELALH
AVEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGVIEEDDVTGLTLIAEPVGVVCGITP
TTNPTSTAIFKSLISLKTRNPIIFAFHPSAQESSAHAARIVRDAAIAAGAPENCVQWIEQ
PSIDATNALMNHDGIATILATGGNAMVKAAYSCGKPALGVGAGNVPAYVEKSANIRQAAH
DIVMSKSFDNGMVCASEQAVIIDKEIYKEFVEEFKSYHTYFVNKKEKALLEEFCFGAKAN
SKNCAGAKLNPNIVGKSAVWIAEQAGFTVPEGTNILAAECTEVSEKEPLTREKLSPVIAV
LKAESTEDGVEKARQMVEFNGLGHSAAIHTKDADLAREFGTRIRAIRVIWNSPSTFGGIG
DVYNAFLPSLTLGCGSYGRNSVGDNVSAINLLNIKKVGRRRNNMQWFKVPSKTYFERDSI
QYLQKCRDVERVMIVTDHAMVELGFLDRIIEQLDLRRNKVVYQIFAEVEPDPDITTVMKG
TDLMRTFKPDTIIALGGGSPMDAAKVMWLFYEQPEVDFHDLVQKFMDIRKRAFKFPELGK
KTKFVAIPTTSGTGSEVTPFAVISDKANNRKYPIADYSLTPTVAIVDPALVMTVPGFIAA
DTGMDVLTHATEAYVSQMANDYTDGLALQAIKIVFDYLERSVKDADFEAREKMHNASTMA
GMAFANAFLGISHSMAHKIGAQFHTVHGRTNAILLPYVIRYNGTRPAKTATWPKYNYYRA
DEKYQDIAKLLGLPAATPEEAVESYAKAVYDLGTRLGIKMNFRDQGIDEKEWKEKSRELA
FLAYEDQCSPANPRLPMVDHMQEIIEDAYYGYEERPGRRK
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaaaactaaagcagtagaaactacagatgttgctcttgcaattgatacattg
gttcaaaatggtttaaaagcacttgatgagatgcgtcaacttaatcaagaacaagttgat
tatattgtagctaaagcttctgttgcagccttggatgcccatggagaacttgctcttcat
gcagtagaagaaactggtcgtggtgtctttgaagataaagcgacaaaaaatttatttgca
tgtgaacacgtcgttaacaacatgcgtcatacaaagacagtgggagttattgaagaagac
gatgtcacaggcttgacattaattgctgaaccagtgggagttgtctgtggtatcacgcca
acaaccaacccaacttcaactgctattttcaagtcattaatctctcttaaaacacgtaat
ccaattatttttgccttccacccatcagcacaagaatcatcagcacatgcagcacgtatt
gttcgtgatgctgctattgctgctggagctcctgaaaattgtgtccaatggattgaacaa
ccatcaattgatgcaactaatgctttgatgaaccatgatggtattgccactatccttgcg
acaggtggtaatgcgatggttaaagctgcctactcatgtgggaaacctgcccttggtgta
ggtgctgggaatgttccagcttatgttgaaaaatcagctaatatccgacaagccgctcac
gatattgttatgtctaaatcatttgataacggtatggtatgtgcatcagaacaggctgtt
attattgataaagaaatttataaagaatttgttgaagaatttaaatcttatcatacctat
ttcgttaataagaaagaaaaagctcttcttgaagaattctgttttggtgcaaaagcaaat
agcaaaaactgtgctggtgcaaaattaaatccaaatattgttggaaaatcagcagtttgg
attgctgaacaagctggatttactgttccagaaggaacaaatattcttgccgcagaatgt
actgaagttagtgaaaaagaacctttgacacgtgaaaaactatcacctgttattgcagta
ttgaaagctgaatctacagaagatggtgttgaaaaagctcgtcaaatggttgagtttaat
ggtctagggcactcagctgctattcatacaaaagatgcagacttagctcgtgaatttgga
actagaattcgtgctatccgtgttatttggaattctccttctacttttggtggtattggg
gatgtttacaatgctttcttgccatcattgactcttggttgtggttcgtatggacgtaac
tcagttggtgataacgttagtgctataaatctcttgaatatcaaaaaagtaggaagacgt
agaaataatatgcaatggtttaaagtcccttcaaaaacatacttcgaacgtgattctatt
caatatttgcaaaaatgtcgcgatgttgaacgtgtcatgattgttacagatcacgccatg
gttgagcttggtttcttggatcgtatcattgaacaacttgatcttcgtcgcaataaagtt
gtttatcagatttttgctgaagtagaaccagatccagacattacaacagtaatgaaagga
acagatttgatgcgtaccttcaaaccagacactattattgcattaggtggtggttctcct
atggatgctgcgaaagttatgtggctcttctatgaacaaccagaagttgatttccatgac
ctcgttcaaaaattcatggatatccgtaaacgtgcgttcaaattcccagaacttggtaag
aaaacaaaatttgttgctattccaacaacttctggaacaggttctgaagtgacaccattt
gccgttatctctgacaaagcaaataatcgtaaatatccaatcgctgattattcattaaca
ccaactgtagctatcgttgatccggcccttgttatgactgttcctggttttattgcggct
gatacgggtatggatgtattgacacatgcaacagaggcttatgtttcacagatggcaaat
gattatacagacggacttgctcttcaagcaattaaaattgtgtttgactacttagaacgc
tcagtaaaagatgctgattttgaagcacgtgaaaagatgcacaatgcgtcaactatggca
ggtatggctttcgccaatgcattcttaggtatttctcactcaatggcgcataaaattggc
gcacaattccataccgtacacggacgtacaaatgcaattcttttgccgtatgttatccgc
tataatggaactcgtccagctaaaacagcaacatggcctaagtacaattactatcgtgct
gacgaaaagtatcaagatatcgctaaattactcggcttaccagcagcaacaccagaagaa
gctgtcgaatcatatgcaaaagctgtgtatgaccttggaacacgtttaggtattaagatg
aatttccgcgaccaaggcattgatgaaaaagaatggaaagaaaaatctcgtgaactagct
ttcttagcatatgaagatcaatgttcaccagcaaatccacgccttccgatggtagatcac
atgcaagaaatcatcgaagatgcttattatggttatgaggaacgtccaggacgtcgtaag
taa

DBGET integrated database retrieval system