KEGG   Streptococcus agalactiae 2603 (serotype V): SAG0054Help
Entry
SAG0054           CDS       T00091                                 

Gene name
adhP
Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
Pathway
sag00010  Glycolysis / Gluconeogenesis
sag00071  Fatty acid degradation
sag00350  Tyrosine metabolism
sag00625  Chloroalkane and chloroalkene degradation
sag00626  Naphthalene degradation
sag01100  Metabolic pathways
sag01110  Biosynthesis of secondary metabolites
sag01120  Microbial metabolism in diverse environments
sag01130  Biosynthesis of antibiotics
sag01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sag00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAG0054 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    SAG0054 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SAG0054 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAG0054 (adhP)
   00626 Naphthalene degradation
    SAG0054 (adhP)
Enzymes [BR:sag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAG0054 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Methyltransf_25 Methyltransf_31 FtsJ MTS ADH_N_2
Motif
Other DBs
NCBI-GeneID: 1012804
NCBI-ProteinID: NP_687090
UniProt: Q8E2D4
Position
72071..73087
Genome map
AA seq 338 aa AA seqDB search
MKAVVVNQASTGVEVVEHDLPKVGHGEALVKVEYCGVCHTDLHVAHGDFGQVPGRILGHE
GIGIVEEIGEGVTSLRVGDRVSIAWFFEGCGHCEYCTTGRETLCRSVKNAGYSVDGGMSE
YAIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKEAGAAPGQWIAVYGAGGLGNLAVQ
YAKKVFNAHVVAVDINADKLQLAKEVGADLTVNGKEIKDVAAYIQEKTGGCHGVVVTAVS
KVAFNQAIDSVRAGGTVVAVGLPSEYMELSIVKTVLDGIRVVGSLVGTRKDLEEAFAFGA
EGLVVPVVEKVPVDTAPQVFDEMERGLIQGRKVLDFTK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggttgttgttaatcaagctagtacaggtgttgaagttgttgagcatgatctt
ccaaaagttggtcatggtgaagcacttgtaaaagtagaatactgtggtgtatgccatact
gatttacacgttgcacatggagatttcggccaggtaccaggacgcattttgggtcacgaa
ggcattggtatagtagaagaaattggagaaggcgtaacgtctttgagggttggtgatcgt
gtctctattgcatggttctttgaagggtgcggtcattgcgaatactgtactacaggacgt
gagacactttgtcgtagtgttaaaaatgctggatacagtgttgatggtggtatgagtgaa
tacgctattgttaccgcggactatgcggttaaggttcctgagggattagacccagctcaa
gcatcatcaatcacttgtgctggagtaacaacatacaaggctatcaaagaagctggagct
gctcctggtcagtggattgcagtgtatggtgcaggtggtcttggaaacttagcagtccaa
tatgcaaaaaaagtattcaatgctcatgttgtagctgttgatattaacgcagataaactt
caattagctaaagaggttggagcagatttgacagttaatggcaaagaaataaaagatgtt
gcggcatatattcaagaaaagacaggcggttgtcatggagtggttgtgactgctgtttct
aaagttgcgtttaatcaggcgattgacagcgttcgtgctggaggtacagtggtagctgtc
ggtcttccatcagaatatatggaattgagtattgtaaaaacagtacttgatgggattcgt
gtggttggttccttagttggaactcgtaaagacttagaagaagccttcgcatttggagca
gaaggcttggtagtaccggtggttgaaaaagtgcctgtggatacagctcctcaagtattc
gatgaaatggaaagaggattgattcaaggacgtaaagttcttgactttacaaagtga

DBGET integrated database retrieval system