KEGG   Streptococcus agalactiae 2603 (serotype V): SAG0055Help
Entry
SAG0055           CDS       T00091                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sag00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAG0055 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAG0055 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SAG0055 (thrC)
Enzymes [BR:sag01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SAG0055 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
73207..74697
Genome map
AA seq 496 aa AA seqDB search
MAIVYQSTRDASNKVTASQAILKGLADDGGLFTPITFPKVDLDFTKLKDASYQEVAKLVL
SAFFDDFTEQELDYCISQAYDTKFDTTEIAPIVKIGDRYHLELFHGPTIAFKDMALSILP
YLLTTAAKKQGVDNKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKNGVSYIQELQMI
TQAGQNTHVVAIEGNFDDAQTSVKEMFNNSLLRLKLSQQHMQLSSANSMNIGRLVPQIVY
YIYAYAQLVKSKEISIGQPINFSVPTGNFGNILAAYYASQIGLPVTKLICASNDNNVLTD
FFKTQTYDKNREFKVTSSPSMDILVSSNLERLIFHLLGDDAETTKKLMEDLVTTGEYALE
ARQANILESFVAGFATEQFVELDIKHLFDQYQYIEDPHTAVASAVYQAYQTETKDQTPAV
IVSTASPYKFPCVVTKAITNKEEIQDFAAISILNDLSGVSLPKAVTDLQKAEVIHRTVVP
TSNMRETVEECLGLKQ
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagtatatcaatcaacacgtgatgctagtaataaagtgacagctagtcaagcg
attctaaagggattagctgacgatggaggactctttacccccatcacatttccaaaagtt
gatttagatttcactaaacttaaggatgcttcctaccaagaagtggctaaactcgttttg
tcagctttttttgatgattttactgaacaagaattggattactgtattagtcaagcttat
gatactaaatttgatacaactgaaatagccccgatagtaaagattggagaccggtatcac
cttgaattatttcacggtcctacaattgcatttaaagatatggctttatccattcttcct
tatttgctaacaacagcagccaaaaaacaaggggttgataataaaatcgttattttaaca
gcaacatcaggtgacactggcaaggcagcgatggcaggttttgcagatgttccaggaact
gagattattgtcttttatcctaaaaatggtgttagttatatccaagaattgcagatgata
acacaagccggacaaaatactcatgttgttgcgattgaaggaaattttgatgatgcacag
acttcagttaaagaaatgttcaataattcccttcttcgattaaaattatcacagcagcat
atgcagttatcatcagccaattcaatgaacatcggtcgccttgttcctcaaattgtttac
tatatatatgcatatgctcaattagttaagtcaaaggaaatctcaattggtcaaccaatt
aattttagtgtacctacaggaaattttggtaatattttagcagcatattatgctagtcaa
attggattacctgttaccaaactcatttgtgcctcaaatgataataacgttctaacagat
ttttttaagacacaaacctacgataaaaatcgagaatttaaagtgacatcaagtccctct
atggatattttggtctcctctaatctagaacgattaatctttcaccttttaggcgatgat
gcagaaacgactaaaaaattaatggaagatttagtgactactggggagtatgccttagag
gctaggcaagcaaatattttagagagctttgtagcgggatttgcgacagaacaatttgtt
gaattagacatcaaacatttatttgaccagtatcagtatatagaggatccgcatacagct
gtagcatcagctgtttatcaagcttatcagacagaaactaaagatcaaactccagcagta
attgtgtcaacagcaagtccttataagttcccgtgtgttgttacaaaggctattacaaat
aaagaagagatacaggatttcgctgctatttcaatcttaaacgatttgtcaggtgtttct
ttacctaaggcggttacagatctacaaaaggccgaagtaatccatagaacggtagtacct
acctcaaatatgcgagaaacggttgaagagtgtctaggtttgaaacaataa

DBGET integrated database retrieval system