KEGG   Streptococcus agalactiae 2603 (serotype V): SAG0118Help
Entry
SAG0118           CDS       T00091                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sag00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SAG0118 (rbsK)
Enzymes [BR:sag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SAG0118 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(128366..129277)
Genome map
AA seq 303 aa AA seqDB search
MSNIVIIGSISMDLVMETNRIAKEGETVFGQRFSMVPGGKGANQAVAIGRLSQERDNITI
LGAIGEDSFGPILLDNLNKNHVTTDFVGTIPSSSGVAQITLYNNDNRIIYCPGANGKVDT
KKWSQEWSIIKEADLVVLQNEIPHQANMKIANFCKEHSIKLLYNPAPSRETDIEMLDKVD
YFTPNEHECQELFPNQKLEDILATYPEKLIVTLGTKGAIYSDGKESHLIPALETKAVDTT
GAGDTFNGAFGYAISKKFKIAKALRFATLAAHLSVQKFGAQGGMPTIKEMEDNQHYEKDW
YIK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacattgtcattatcggtagtatttccatggacttagttatggaaaccaatcgt
atcgccaaagagggagaaaccgtatttggccaacgtttttcaatggttccaggaggtaaa
ggtgctaatcaggctgtcgctattgggcgtcttagccaagagcgagataatattactatt
cttggtgccattggcgaggattcttttggtcccattcttttggataatttaaacaaaaat
catgttactacggattttgtgggaacgataccatcttcttcaggtgttgcccaaatcact
ctttataataatgataatcgaatcatttactgtcctggagccaacggaaaagttgatact
aaaaaatggtctcaggagtggtcaataattaaagaagctgatttagttgtattacaaaat
gaaattcctcatcaagcaaatatgaaaattgctaatttttgtaaagaacatagtattaaa
ttactctataatcctgcaccatctagagagactgatattgagatgctcgataaggtcgat
tatttcacaccaaatgaacacgaatgtcaagagctgttcccaaaccaaaaactagaggat
atattagccacatatcctgaaaaactaatcgtaacactcggcacaaaaggagccatctac
tctgatggaaaagaaagtcatttaattcctgctttagaaactaaagctgttgatacaact
ggtgcaggtgatacttttaacggtgcattcggttatgctatctcgaaaaaatttaagatt
gctaaggccttacgttttgcaactctagctgctcacttatccgtgcaaaaatttggtgca
cagggtggcatgcctacaattaaagaaatggaggacaaccaacattatgaaaaagactgg
tatattaaatag

DBGET integrated database retrieval system