KEGG   Streptococcus agalactiae 2603 (serotype V): SAG0274Help
Entry
SAG0274           CDS       T00091                                 

Definition
alpha-glycerophosphate oxidase
Orthology
K00105  
alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sag00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SAG0274
Enzymes [BR:sag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     SAG0274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
279655..281484
Genome map
AA seq 609 aa AA seqDB search
MEFSRETRRLALQRMQDRTLDLLIIGGGITGAGVALQAAASGLDTGLIEMQDFAEGTSSR
STKLVHGGLRYLKQFDVEVVSDTVSERAVVQQIAPHIPKPDPMLLPVYDEPGSTFSMFRL
KVAMDLYDLLAGVTNTPAANKVLSAEDVLKREPDLQKEGLLGGGVYLDFRNNDARLVIEN
IKRANRDGAYIASHVKAEDFLFDDNNQIIGVRARDLLTDQVIDIKARLVINTTGPWSDTV
RNFSNEGKQIHQLRPTKGVHLVVDRQKLNISQPVYVDTGLNDGRMIFVLPREDKTYFGTT
DTDYHGDLEHPTVTKEDVDYLLNIVNKRFPEAELTIDDIESSWAGLRPLLSGNSASDYNG
GNSGKLSDESFEELIDSVKDYIAHKNHREDVEKAISHVESSTSEKELDPSAVSRGSSFER
DDNGLLTLAGGKITDYRKMAEGAMETIINILDKEYNRKFKLINSKTYPVSGGEINPSNVD
SEIEAYAQLGTLSGLSIEDARYIANLYGSNAPKLFALTRQITEAEGLSLVETLSLHYAMD
YEMALSPTDFFLRRTNHMLFMRDNLDSLIQPVIDEMAKHYQWSDQDKTFYEEELHETLKD
NDLAALKDN
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcacgagaaacacgacgtttagccttacaaagaatgcaagatcgtactctg
gatttacttatcataggtgggggtatcacaggcgctggtgtcgctttacaagcagcagct
agtggattagatactggacttattgaaatgcaagattttgcagaagggacaagtagtcgc
tcaacaaaattggtccatggtggtcttcgttacttgaagcaatttgatgtagaagttgtt
tctgatacagtatcagagcgtgcagtcgtgcagcaaattgcaccacacattcctaagcca
gatccaatgcttttaccggtttacgatgagccgggttctacttttagtatgtttcgcctt
aaagtggctatggatttatatgatttattagcaggtgtgacaaacacacccgcagccaat
aaagttttaagcgcagaagatgttcttaagcgtgagcctgatttacaaaaagaaggtttg
ctaggcggaggggtctatttagatttccgtaataacgatgcacgcctagtgattgaaaat
attaaacgcgctaatagggatggagcttatattgccagtcatgtcaaagctgaggacttc
ttatttgatgacaacaatcaaattataggagtacgtgcgcgtgatttgttgactgaccaa
gttatcgatataaaagctaggcttgttattaatacaactggaccttggagtgacaccgtt
cgcaacttctccaatgaaggtaaacaaattcatcaattacgtccaactaagggagttcac
ttagttgtagatcgccaaaaattaaatatttctcaacctgtttatgttgatacaggcctg
aatgatggtcgtatgatttttgttttgccacgtgaagataagacttattttggaactaca
gatactgattaccatggagacttagaacatcctacggtaactaaagaagatgttgactac
ctccttaatattgtaaacaaacgcttcccagaagcagagcttactattgatgatattgag
agttcatgggcaggtttgcgtccactactatcagggaatagtgcctctgactataatgga
ggcaatagtggaaaactaagcgatgaaagttttgaagaattaattgattccgttaaagat
tatattgcacataaaaatcatcgtgaggatgttgaaaaagctatttctcatgtagaatct
agtacttctgaaaaagaattggacccatcagctgtttctcgaggatcaagttttgagcgt
gatgataatggcctattaacacttgctggtggtaaaattactgattatcgaaaaatggca
gaaggtgccatggaaactattattaacattttggataaagaatataatcgcaagtttaaa
ctaatcaattctaaaacctatcctgtttcaggaggagagattaacccatctaatgttgat
tctgaaattgaagcttatgctcaattgggcacactaagtggtttaagtattgaggatgca
cgttatattgctaacctttatgggtcaaatgcaccaaaattatttgcattgacacgccaa
attacagaagcagaaggtctgagcttggtagaaacgttgtcacttcactatgctatggat
tatgaaatggcgcttagcccaacggatttcttcttaagacgtacgaaccatatgcttttc
atgagagataatttagattctttgattcagcctgttattgatgagatggctaaacattat
caatggtctgatcaagacaaaactttctatgaagaagaattacatgagactctaaaagac
aatgacttggcagctttgaaggataattga

DBGET integrated database retrieval system