KEGG   Streptococcus agalactiae 2603 (serotype V): SAG0283Help
Entry
SAG0283           CDS       T00091                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sag00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SAG0283 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SAG0283 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SAG0283 (proB)
Enzymes [BR:sag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SAG0283 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
291764..292567
Genome map
AA seq 267 aa AA seqDB search
MKRHFETTRRIVIKVGTSSLVQTSGKINLSKIDHLAFVISSLMNRGMEVILVSSGAMGFG
LDILKMDKRPQEISQQQAVSSVGQVAMMSLYSQIFSHYQTHVSQILLTRDVVVFPESLQN
VTNSFESLLSMGILPIVNENDAVSVDEMDHKTKFGDNDRLSAVVAKITKADLLIMLSDID
GLFDKNPNIYDDAVLRSHVSEITDDIIKSAGGAGSKFGTGGMLSKIKSAQMVFDNNGQMI
LMNGANPRDILKVLDGHNIGTYFAQGK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagacattttgagacaactagaagaattgttattaaagtaggaaccagttccctc
gtacagacaagcgggaaaattaatttaagtaaaatagaccatttagcatttgttatttct
agtcttatgaatagaggcatggaggtgattttagtatcatctggtgctatggggtttggt
ttagacattttgaaaatggataagcgtcctcaagaaatatcacaacaacaagcagtttct
agcgtaggacaagtagccatgatgagtctttattctcagatattttcgcactatcaaact
catgtttcccaaattttattaacacgtgacgttgtggtttttccagagagtttgcaaaat
gtaacaaactcttttgagagtctgctctctatgggaattttgccaatcgtcaatgagaat
gatgctgtcagcgtggatgagatggatcataaaacgaagtttggggataatgaccgtctc
tctgctgtcgttgctaaaattactaaagcagatttattaattatgctgtcagatattgat
ggtctttttgataaaaatcctaatatttatgatgatgctgttttacgtagtcatgtttct
gaaatcaccgatgacatcatcaagtcagctggaggagcaggaagtaaatttggtactggg
ggcatgcttagtaaaattaaaagtgcacaaatggtgtttgataacaatggacaaatgata
ttgatgaatggcgccaatcctcgtgatattttaaaggtgttagatgggcataatattgga
acttattttgctcaaggaaagtga

DBGET integrated database retrieval system