KEGG   Streptococcus agalactiae 2603 (serotype V): SAG0428Help
Entry
SAG0428           CDS       T00091                                 

Definition
zinc-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
Pathway
Glycolysis / Gluconeogenesis
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sag00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SAG0428
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAG0428
  Lipid metabolism
   00071 Fatty acid degradation
    SAG0428
  Amino acid metabolism
   00350 Tyrosine metabolism
    SAG0428
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SAG0428
   00626 Naphthalene degradation
    SAG0428
Enzymes [BR:sag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SAG0428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(442266..443303)
Genome map
AA seq 345 aa AA seqDB search
MKVATFIEPGKMVITDTPKPVIEQETDAVIKIVRACVCGSDLWWYRGISKRESGSFAGHE
AIGIVEEVGTKVTDVSKGDFVIVPFTHGCGQCPSCKAGFDGNCTNHQAAKNVGYQGQYLR
YTNANWALVKIPGQPSDYDNETLNSLLTLSDVMATGYHAAATAEVKEGDTVVVMGDGAVG
LCGVIAAKMLGANRIIAMSRHKDRQELALTFGATDIVEERGDEAVKRVLDLTNQAGADAV
LECVGTEQSVDTATQIARPGAVIGRVGIPQNPDMNTNNLFWKNIGLRGGIASVTTFDKSV
LLDAVLTHKINPGLVFTKSFVLDDIQKAYEAMDKRDAIKSLVIVD
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagctacatttattgaacctggcaaaatggttataactgatacaccaaaacca
gtcattgaacaagagacagatgctgttatcaaaattgttagagcctgtgtttgtggttca
gacttgtggtggtatcgtggtatttcaaaacgtgaaagtggttcttttgcaggtcatgag
gctattggtatcgttgaggaagttggtactaaagtaactgacgtgtcaaaaggtgatttt
gttattgttccctttacacatggctgtggccaatgtccgtcttgtaaggctggatttgat
ggaaattgtacaaatcatcaagctgcaaaaaatgtaggataccaaggtcaatatctacgt
tatactaatgcaaactgggcattggttaagatcccaggacaaccttctgattatgataat
gagactcttaactctctgctcaccttatcagatgtaatggcaactggttatcatgctgca
gcaactgcagaagttaaagaaggtgacacggtagttgtcatgggagatggtgctgttgga
ctctgtggtgttatcgctgctaaaatgttaggtgctaaccgtatcattgcaatgagtcgt
cacaaagataggcaggaactagcattgacttttggtgcaacggatattgtcgaagaacgg
ggtgacgaagccgttaaacgtgttttagatttaaccaatcaagcaggtgccgatgctgtt
ttagaatgtgttggtacagagcagtctgttgatacagctacccaaattgctaggcctggt
gctgtcataggacgtgttggtatcccacaaaatccagacatgaataccaataatttattc
tggaaaaatatcggccttagaggtggcattgcttctgtaacaacatttgataagtctgtc
cttttagatgctgttctaactcataaaattaacccaggcttagtttttacaaaatccttt
gtattagatgatattcaaaaggcttatgaagcaatggataaacgtgacgctatcaaatcc
ttagtgattgttgactga

DBGET integrated database retrieval system