KEGG   Streptococcus agalactiae 2603 (serotype V): SAG0471Help
Entry
SAG0471           CDS       T00091                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAG0471 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAG0471 (glk)
   00052 Galactose metabolism
    SAG0471 (glk)
   00500 Starch and sucrose metabolism
    SAG0471 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SAG0471 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SAG0471 (glk)
   00524 Butirosin and neomycin biosynthesis
    SAG0471 (glk)
Enzymes [BR:sag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SAG0471 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
484171..485139
Genome map
AA seq 322 aa AA seqDB search
MSKKLLGIDLGGTTIKFGILTLEGEVQEKWAIETNTLENGRHIVSDIVESLKHRLSLYGL
TKDDFLGIGMGSPGAVDRTSKTVTGAFNLNWADTQEVGSVIEKEVGIPFFIDNDANVAAL
GERWVGAGANNPDVVFVTLGTGVGGGVIADGNLIHGVAGAGGEIGHMIVDPENGFTCTCG
NKGCLETVASATGVVRVARQLAEQYEGSSAIKAAIDNGDTVTSKDIFIAAEDGDKFANSV
VERVSRYLGLAAANISNILNPDSVVIGGGVSAAGEFLRSRVEKYFVTFAFPQVKKSTKIK
IAELGNDAGIIGAASLANQQAS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagaaattattgggaattgacctcggaggaacgaccattaaatttggtatcttg
acgcttgagggagaagtacaagaaaaatgggcaattgagaccaatactttagaaaacgga
agacatatcgtttctgatatcgttgaatctctcaaacatcgtttgagcctctatggatta
acaaaagatgactttctcggtatcggtatgggttctccaggagctgttgatagaactagt
aaaacagtaacaggtgcttttaatctaaattgggctgatactcaagaagtaggttcagtt
attgaaaaagaagttggaattccattttttattgataacgatgctaatgttgcagcactt
ggtgaacgctgggtaggtgctggtgccaataatcccgacgttgttttcgtaaccctcgga
acaggagtaggtggaggtgttatcgcagatggtaacctcatccatggtgttgcaggagca
ggtggagaaattgggcatatgattgttgatccagaaaatggatttacgtgcacatgtggt
aacaaaggctgccttgagacagttgcatcagcgacaggtgttgttagagtagcacgtcaa
ctcgcagaacaatatgagggttcgtctgccattaaagcagcgattgacaacggtgatact
gttacaagtaaagatatttttatagcagcagaagatggggataaatttgctaattctgtt
gttgaacgtgtatcacgttaccttggactggcagcagctaatatttcaaatattttaaac
cctgattctgtggttattggtggcggtgtctcagcagcaggtgaatttttacgtagtcgc
gttgagaaatactttgtcacatttgctttcccacaagttaaaaagtcaactaaaattaag
attgctgaactaggtaatgatgctggtattattggtgcagcaagcttagccaatcaacaa
gcaagttaa

DBGET integrated database retrieval system