KEGG   Streptococcus agalactiae 2603 (serotype V): SAG0766Help
Entry
SAG0766           CDS       T00091                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sag00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SAG0766 (recR)
DNA repair and recombination proteins [BR:sag03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SAG0766 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
762797..763393
Genome map
AA seq 198 aa AA seqDB search
MLYPTPIAKLIDSFSKLPGIGTKTATRLAFYTIGMSDEDVNEFAKNLLAAKRELTYCSVC
GNLTDDDPCLICTDKTRDQSVILVVEDSKDVSAMEKIQEYNGLYHVLHGLISPMNGISPD
DINLKSLITRLMDGQVTEVIVATNATADGEATSMYISRVLKPAGIKVTRLARGLAVGSDI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgctttacccaacaccaattgctaaattgattgacagcttttcaaaattaccgggtata
ggtactaaaacagcaacacgtttagctttttacaccattggtatgagtgatgaagatgtt
aatgaatttgctaagaatttattagctgctaagcgggaattaacctattgttctgtttgt
ggtaatttgactgatgatgatccttgcttaatttgtacagataagacgcgtgaccagtct
gttatcttggttgttgaagatagtaaagatgtgtcagctatggaaaaaattcaagagtat
aatggtttgtatcatgtcttacatggcttaatttcacctatgaatggtattagccctgat
gacattaatttgaaaagtttaattactcgattgatggatggtcaggtgacagaagttatt
gttgctaccaatgcgactgctgatggtgaagctacatcaatgtatatttcacgagtctta
aaaccagctggtatcaaagtgacacgattagcgagaggtttagctgttggttcagatatc
gaatatgcagatgaagtaaccttgcttcgagcaatcgaaaatcgtacagagttataa

DBGET integrated database retrieval system