KEGG   Streptococcus agalactiae 2603 (serotype V): SAG0940Help
Entry
SAG0940           CDS       T00091                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAG0940 (pfkA)
   01230 Biosynthesis of amino acids
    SAG0940 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAG0940 (pfkA)
   00030 Pentose phosphate pathway
    SAG0940 (pfkA)
   00051 Fructose and mannose metabolism
    SAG0940 (pfkA)
   00052 Galactose metabolism
    SAG0940 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    SAG0940 (pfkA)
Enzymes [BR:sag01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SAG0940 (pfkA)
Protein phosphatases and associated proteins [BR:sag01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SAG0940 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
946732..947754
Genome map
AA seq 340 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGMEVYGINQGYYGMVTGDIFPLDANSVGDT
INRGGTFLRSARYPEFAELEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDYTIGFDTAVATAVENLDRLRDTSASHNRTFVVEVMGRNAGDIALWS
GIAAGADQIIVPEEEFNIDEVVSNVRAGYAAGKHHQIIVLAEGVMSGDEFAKTMKAAGDD
SDLRVTNLGHLLRGGSPTARDRVLASRMGAYAVQLLKEGRGGLAVGVHNEEMVESPILGL
AEEGALFSLTDEGKIVVNNPHKADLRLAALNRDLANQSSK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttaactagtggtggtgacgcccctggtatgaacgctgctatc
cgtgcagttgttcgtaaagcaatttctgaaggtatggaagtttacggcatcaaccaaggt
tactatggtatggtgacaggggatattttccctttggatgctaattctgttggggatact
atcaaccgtggaggaacgtttttacgttcagcacgttatcctgaatttgctgaacttgaa
ggtcagcttaaagggattgaacagcttaaaaaacacggtattgaaggtgtagtagttatc
ggtggtgatggttcttatcatggtgctatgcgtctaactgagcacggtttcccagctgtt
ggtttgccgggtacaattgataacgatatcgttggcactgactatactattggttttgac
acagcagttgcgacagcagttgagaatcttgaccgtcttcgtgatacatcagcaagtcat
aaccgtacttttgttgttgaggttatgggaagaaatgcaggagatatcgctctttggtca
ggtatcgctgcaggtgcagatcaaattattgttcctgaagaagagttcaatattgatgaa
gttgtctcaaatgttagagctggctatgcagctggtaaacatcaccaaatcatcgtcctt
gcagaaggtgttatgagtggtgatgagtttgcaaaaacaatgaaagcagcaggagacgat
agcgatcttcgtgtgacgaatttaggacatctgctccgtggtggtagtccgacggctcgt
gatcgtgtcttagcatctcgtatgggagcgtacgctgttcaattgttgaaagaaggtcgt
ggtggtttagccgttggtgtccacaacgaagaaatggttgaaagtccaattttaggttta
gcagaagaaggtgctttgttcagcttgactgatgaaggaaaaatcgttgttaataatccg
cataaagcggaccttcgcttggcagcacttaatcgtgaccttgccaaccaaagtagtaaa
taa

DBGET integrated database retrieval system