KEGG   Streptococcus agalactiae 2603 (serotype V): SAG1724Help
Entry
SAG1724           CDS       T00091                                 

Definition
helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sag03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1717459..1719879
Genome map
AA seq 806 aa AA seqDB search
MEVFFTGTIERIIFENASNFFKILLLEIEDTDSDFDDVEVIITGTMADVIEGEEYTFWGT
LTQHPKYGEQLQSVRYERAKPTSGGLVKYFSSEQFKGIGKKTAQRIVELYGDNTIDKILE
SPEQLSTISGLSKINREAFIAKLKLNYGTEQVLAKLAEYGLSNRAAIQIFDHYKEESLEV
INENPYQLVEDIQGIGFKIADQLAEQVGIESDSPKRFRAAIIHTLVESSMEQGDTYIEAR
TLLEKTITLLEEARQIELDPSIVAKELTNLIAEDKVQHIGTKIFSNTLFFAEEGIKKNLQ
RILNQPLDKQLNHKDIDREIRDIQKSLNIHYDNIQEKAIREALLSKVFILTGGPGTGKTT
VINGIIEAYSELHHIDLNKNDIPIVLAAPTGRAARRMNELTGLPSATIHRHLGLNGDSDY
QSLDDYLDCSLIIIDEFSMVDTWLANQLFDALDSHTQVIIVGDSDQLPSVGPGQVLADLL
NINALPHVKLEKIFRQSEESTIVTLANQMRQGFLPEDFTAKKADRSYFEASANIIPNMIS
KIVQSALKSGIEAHEIQILAPMYRGQAGINNLNLIMQNLLNPLKDNNQFTFNDINFRIGD
KVLHLVNDTELNVFNGDIGYITDLIPAKYTESKQDEIYMTFDGQEVIYQRKEWLKITLAY
AMSIHKSQGSEFQVVILPITRQSGRMLQRNLIYTAITRSKSKLILLGEIGAFDFAVKNEG
AKRNTYLIERFENKQEIANSQKIEDSSIDQKIDNTIINTSIPKTATPIEQTNLSKITYRL
TEENYLTIDPMIGINQQDISAIFDSK
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atggaagtattttttacaggaaccattgaacgcattatatttgaaaatgccagcaatttt
tttaaaatattacttctggaaatcgaagatacggatagcgattttgatgatgtagaagta
attattactggtactatggccgacgttatagagggagaagaatatactttttggggaaca
ctaacccaacatccaaaatacggcgagcaactacaaagtgtacgctatgaaagagccaag
cctacttcaggtggccttgtgaaatacttttctagcgaacaatttaaaggaattggtaaa
aagactgcccaacgcatcgtagaactctatggagataataccattgataaaatccttgaa
tcccctgaacagttaagtacaatctcaggactatcaaaaattaatagagaagcattcatc
gctaaactgaaactcaattatggaacagagcaagttttagctaaactcgctgaatatggg
ttaagcaatcgtgctgctattcaaatatttgatcactataaagaagaatcacttgaagtg
ataaacgaaaatccttatcaacttgttgaggatatccaaggtatcggttttaaaatagct
gaccaacttgctgaacaagtcggtattgaaagtgattctcctaaacgctttcgtgctgct
attattcatactttagttgagtcttctatggagcaaggagatacctatattgaggctcgt
actctcttggaaaaaaccattactctccttgaagaagctcgtcaaatcgaactagatcct
tcaattgttgctaaggaattgacaaatttaattgcagaagataaagtgcaacatattgga
actaaaatttttagtaatactctattttttgccgaagaaggcatcaaaaaaaacttacaa
cgaatactaaatcagcctcttgataaacaactaaatcacaaagatattgaccgtgaaatc
agagatattcaaaaatctttaaatatccactacgataatatccaagaaaaagctattaga
gaagctttactaagtaaggtatttatcttgactggtggcccaggaacaggtaaaacaaca
gttataaatggtattattgaagcctattccgagttacatcatattgatttaaacaaaaat
gatattcctattgtacttgctgctcctacaggtcgtgctgctagacgcatgaatgaactt
accggtttaccgagtgctactattcataggcatttgggattaaacggagatagtgactat
caaagtctagatgactatctagattgttccttaattatcattgatgaattttcaatggtt
gacacttggcttgctaatcaattatttgacgctttggactcgcacacacaagttattatt
gtcggagatagtgatcaattaccgtctgtaggtccaggacaagttctagcagatctttta
aatataaatgcacttccacacgttaaacttgaaaagatttttagacaatcagaagaatca
actattgtgactttagctaatcaaatgagacagggctttttgccagaggactttacagct
aaaaaagccgatcgctcatactttgaagcatctgctaatatcatcccaaatatgatttct
aaaattgttcaatctgcacttaagagcggtattgaagctcatgaaattcaaattttagct
cctatgtatcgcggccaagcaggtattaataatcttaaccttatcatgcaaaatctcctc
aatccattaaaagataataaccaatttacttttaatgatataaatttccgaataggagat
aaagtgttacatttagtcaacgatacagagcttaatgtttttaatggggatattggttac
ataacggaccttataccagccaaatatactgagagcaagcaagatgagatttatatgact
tttgacggtcaagaagttatctatcaacgcaaagaatggcttaaaataacactagcctat
gctatgagtattcataaatcacagggttctgaatttcaagttgttattctgccaataacg
agacagagtggtcgaatgttacagcgaaaccttatttatacagctattacgagatctaaa
agtaaactaatacttttaggagaaattggtgcatttgatttcgctgttaaaaacgagggg
gcaaagcgcaatacttatctgatagaaagatttgaaaacaagcaagaaatagctaattct
caaaaaattgaagatagctcaatagatcaaaagattgacaacacaataattaatacgtcc
attccaaaaacagcaacaccaattgagcagactaatctttcaaaaataacttatcgccta
actgaagaaaattatttaacaatcgatccaatgattggtattaatcaacaagatataagt
gcaatttttgatagtaaataa

DBGET integrated database retrieval system