KEGG   Streptococcus agalactiae 2603 (serotype V): SAG2096Help
Entry
SAG2096           CDS       T00091                                 

Gene name
ruvA
Definition
(RefSeq) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sag  Streptococcus agalactiae 2603 (serotype V)
Pathway
sag03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sag00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SAG2096 (ruvA)
Enzymes [BR:sag01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SAG2096 (ruvA)
DNA repair and recombination proteins [BR:sag03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SAG2096 (ruvA)
    RecFOR pathway proteins
     SAG2096 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH HHH_3 Amidase02_C ESX-1_EspG
Motif
Other DBs
NCBI-GeneID: 1014907
NCBI-ProteinID: NP_689081
UniProt: Q8DWW6
Position
complement(2075859..2076449)
Genome map
AA seq 196 aa AA seqDB search
MYDYIKGKLSKITAKFIVVETAGLGYMIYVANPYSFSGYVNQEVTIYLHQVIRDDAHLLF
GFHTENEKEIFLNLISVSGIGPTTALAIIAVDDNEGLVSAIDNSDIKYLTKFPKIGKKTA
QQMILDLSGKFVEASGESATSRKVSSEQNSNLEEAMEALLALGYKATELKKVKAFFEGTN
ETVEQYIKSSLKMLMK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgtacgattatattaaaggaaaattgagtaaaataacggctaaatttattgttgtggaa
acagctggattgggatacatgatatatgtggcaaatccctactctttttcaggttacgtt
aatcaagaagttaccatctacttacatcaagtcattcgcgatgatgcacatcttttattt
ggctttcatacggaaaatgaaaaagaaatttttcttaatttaatttcagtatcaggaatt
ggtccaacgaccgctttagcaattattgcagtcgatgacaatgaaggtctcgtaagtgcc
attgataatagtgatattaagtatttgactaaatttccaaagataggaaaaaaaacagca
caacagatgatccttgatttgtcagggaagtttgtagaagcttctggtgagagtgcgact
agtcgtaaggttagctctgagcagaatagcaatcttgaagaagctatggaagctttgtta
gcgttggggtataaggcgactgaattgaaaaaagtaaaagccttttttgaaggtacgaac
gagactgtggagcaatacatcaaatctagtttgaagatgttgatgaaataa

DBGET integrated database retrieval system