KEGG   Simiduia agarivorans: M5M_00185Help
Entry
M5M_00185         CDS       T02281                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
saga  Simiduia agarivorans
Pathway
saga00020  Citrate cycle (TCA cycle)
saga00310  Lysine degradation
saga01100  Metabolic pathways
saga01110  Biosynthesis of secondary metabolites
saga01120  Microbial metabolism in diverse environments
saga01130  Biosynthesis of antibiotics
saga01200  Carbon metabolism
Module
saga_M00009  Citrate cycle (TCA cycle, Krebs cycle)
saga_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M5M_00185
  Amino acid metabolism
   00310 Lysine degradation
    M5M_00185
Enzymes [BR:saga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     M5M_00185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AFU97274
UniProt: K4KE18
Position
complement(40219..41436)
Genome map
AA seq 405 aa AA seqDB search
MSIEIKAPQFPESVPDGTIATWHKKAGEAVSRDELIVDIETDKVVLEVVAPADGVLAEIL
KDEGETILSNELIARLEEGAAPAASAPAAEAPAAAAAPAAGNDKLVNPSARKMADENNVS
TDAVAGSGKGGRVTKGDVIDHLKGGAPAPAAAAAPAKAAAASTGGIELPAGDRTEKRVPM
SRMRARIAERLLEASQSTAMLTTFNEVDMGPVMELRKKYKDQFEKSHNGTRLGFMGFFVK
AAAEALRRFPAVNASIDGNDVVYHGYQDIGVAVSTDKGLVVPVLRNSENMSLADVENTIR
DFGLRARDGKLGMDDMMGGTFTITNGGVFGSLMSTPILNPPQTAILGMHKIQERPMAVNG
KVEIRPMMYLALSYDHRLIDGKDAVQFLVAIKDMIEDPARILLEI
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgaaatcaaagcaccccagttccctgaatctgtgcccgatggcaccatcgct
acctggcacaaaaaagccggcgaagctgtaagtcgcgatgaactgattgttgatatcgaa
accgacaaagtggttctggaagtggtggcgcccgccgacggcgtactggctgaaatcctg
aaggacgaaggcgaaaccattctttccaacgagctgattgcccgtctggaagaaggtgct
gcgcccgcagcctccgcacccgcggctgaagcacctgccgctgccgcagcacccgccgcc
ggcaacgacaaactggttaacccgtctgcgcgcaaaatggccgacgaaaacaacgtcagc
accgacgccgtggccggttcaggcaagggtggccgggtcaccaaaggtgacgtaatcgat
cacctgaaaggtggcgcacctgctcctgcggctgccgcagcgcccgctaaagccgccgcg
gccagcaccggtggcatcgaactgcccgccggcgatcgcaccgagaagcgtgtgcccatg
tcgcgcatgcgtgcacgcattgccgagcgcctgctggaagccagccagtccaccgccatg
ctcaccacattcaacgaagtggacatgggcccggtgatggaactgcgtaagaaatacaaa
gaccagttcgaaaagtcccacaacggcacccgtctgggcttcatgggctttttcgtgaag
gccgcggccgaagccctgcgtcgcttccccgccgttaacgcctccatcgacggcaacgac
gtggtctaccacggctaccaggacatcggcgtggctgtgtccaccgacaagggtctggta
gtgcccgtgctgcgcaactccgaaaacatgagcctggcagatgtcgaaaacaccatccgc
gacttcggcctgcgcgcccgtgacggcaagctgggtatggatgatatgatgggtggcacc
ttcaccatcactaacggtggtgtgttcggctcgctcatgtccacgcctatcctgaacccg
ccgcaaaccgcgattctgggtatgcacaagattcaggagcgccccatggccgtgaacggc
aaggtggaaatacgccccatgatgtatctggcactgtcatacgatcatcgcctgattgat
ggtaaagatgccgtacaattcctggttgccattaaggacatgatcgaagacccggcacgc
attctgctggaaatctga

DBGET integrated database retrieval system