KEGG   Simiduia agarivorans: M5M_00185Help
Entry
M5M_00185         CDS       T02281                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
saga  Simiduia agarivorans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:saga01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:saga00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:saga00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(40219..41436)
Genome map
AA seq 405 aa AA seqDB search
MSIEIKAPQFPESVPDGTIATWHKKAGEAVSRDELIVDIETDKVVLEVVAPADGVLAEIL
KDEGETILSNELIARLEEGAAPAASAPAAEAPAAAAAPAAGNDKLVNPSARKMADENNVS
TDAVAGSGKGGRVTKGDVIDHLKGGAPAPAAAAAPAKAAAASTGGIELPAGDRTEKRVPM
SRMRARIAERLLEASQSTAMLTTFNEVDMGPVMELRKKYKDQFEKSHNGTRLGFMGFFVK
AAAEALRRFPAVNASIDGNDVVYHGYQDIGVAVSTDKGLVVPVLRNSENMSLADVENTIR
DFGLRARDGKLGMDDMMGGTFTITNGGVFGSLMSTPILNPPQTAILGMHKIQERPMAVNG
KVEIRPMMYLALSYDHRLIDGKDAVQFLVAIKDMIEDPARILLEI
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgaaatcaaagcaccccagttccctgaatctgtgcccgatggcaccatcgct
acctggcacaaaaaagccggcgaagctgtaagtcgcgatgaactgattgttgatatcgaa
accgacaaagtggttctggaagtggtggcgcccgccgacggcgtactggctgaaatcctg
aaggacgaaggcgaaaccattctttccaacgagctgattgcccgtctggaagaaggtgct
gcgcccgcagcctccgcacccgcggctgaagcacctgccgctgccgcagcacccgccgcc
ggcaacgacaaactggttaacccgtctgcgcgcaaaatggccgacgaaaacaacgtcagc
accgacgccgtggccggttcaggcaagggtggccgggtcaccaaaggtgacgtaatcgat
cacctgaaaggtggcgcacctgctcctgcggctgccgcagcgcccgctaaagccgccgcg
gccagcaccggtggcatcgaactgcccgccggcgatcgcaccgagaagcgtgtgcccatg
tcgcgcatgcgtgcacgcattgccgagcgcctgctggaagccagccagtccaccgccatg
ctcaccacattcaacgaagtggacatgggcccggtgatggaactgcgtaagaaatacaaa
gaccagttcgaaaagtcccacaacggcacccgtctgggcttcatgggctttttcgtgaag
gccgcggccgaagccctgcgtcgcttccccgccgttaacgcctccatcgacggcaacgac
gtggtctaccacggctaccaggacatcggcgtggctgtgtccaccgacaagggtctggta
gtgcccgtgctgcgcaactccgaaaacatgagcctggcagatgtcgaaaacaccatccgc
gacttcggcctgcgcgcccgtgacggcaagctgggtatggatgatatgatgggtggcacc
ttcaccatcactaacggtggtgtgttcggctcgctcatgtccacgcctatcctgaacccg
ccgcaaaccgcgattctgggtatgcacaagattcaggagcgccccatggccgtgaacggc
aaggtggaaatacgccccatgatgtatctggcactgtcatacgatcatcgcctgattgat
ggtaaagatgccgtacaattcctggttgccattaaggacatgatcgaagacccggcacgc
attctgctggaaatctga

DBGET integrated database retrieval system