KEGG   Simiduia agarivorans: M5M_00205Help
Entry
M5M_00205         CDS       T02281                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
saga  Simiduia agarivorans
Pathway
saga00020  Citrate cycle (TCA cycle)
saga00190  Oxidative phosphorylation
saga00650  Butanoate metabolism
saga01100  Metabolic pathways
saga01110  Biosynthesis of secondary metabolites
saga01120  Microbial metabolism in diverse environments
saga01130  Biosynthesis of antibiotics
saga01200  Carbon metabolism
Module
saga_M00009  Citrate cycle (TCA cycle, Krebs cycle)
saga_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
saga_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M5M_00205
   00650 Butanoate metabolism
    M5M_00205
  Energy metabolism
   00190 Oxidative phosphorylation
    M5M_00205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AFU97278
UniProt: K4KH62
Position
complement(47253..47621)
Genome map
AA seq 122 aa AA seqDB search
MVTAVTSFGRSGLYDWLIQRVSAIVMAAYTVFITGFVMTTPDLSFDVWRALFDTLWMRVF
TLATIISLAAHAWIGLWAVLTDYLTDRLMGAKATVLRLFAQVVLGAVTLTYTVWAIEILW
GH
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaactgccgtaacgagttttggccgcagcggcctgtacgactggttgatccagcgt
gtcagcgccattgtcatggctgcatataccgtctttattacaggctttgtaatgacaacg
ccggatctgtcctttgacgtatggcgcgcgttgttcgacacgctatggatgcgcgtattt
acactggcgacaatcatttctctcgccgcgcacgcctggatcggcctgtgggccgtactg
accgactacctgacagaccgcctcatgggtgccaaggccactgtgctgcgcctgtttgca
caggtggtactgggagcggtcaccctgacttacacagtctgggccattgaaattctctgg
gggcattga

DBGET integrated database retrieval system