KEGG   Simiduia agarivorans: M5M_00430Help
Entry
M5M_00430         CDS       T02281                                 

Definition
Chemotaxis response regulator protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
saga  Simiduia agarivorans
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:saga02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:saga02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
94046..95116
Genome map
AA seq 356 aa AA seqDB search
MKQISVIVVDDSRLVRELLTEIINADPVLNVVACAEDAYQARELIKLHNPQVITLDVEMP
GMNGIAFLKNLMRLRPMPVLMVSTLTARGSDITLEALELGAVDYVTKPVGDPEHGLQRLA
GEIVQKLKACARANITAIEHNAKQHQFSEVRVVKPDPAAVNPFDVIVIGASTGGTEAIKE
ILCSLPMGMPPVVLVQHLPPKFAENFARRLGVITAFQVMAVSEGIVGLQQNTVYLAGGDW
HLEINRCATGRIGLKVSDTAKVNRHRPSVDVLFNSVAEHVKDRAIGVLLTGMGMDGAAGL
GRMRSAGAYTLAQDKDSCVVWGMPRVAMEQGAVEEVKPLCEMAGRLVQLCFGRRSG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagatcagtgtcatagtagtagacgattctcgcctggtccgtgaactgttgacc
gaaatcataaacgctgatccagtgttgaatgtagttgcctgtgcagaagacgcttaccaa
gcgcgagaactcattaagctgcacaatccgcaggttataacgctcgatgtggaaatgccc
ggcatgaatgggattgcgtttctcaaaaacctgatgcgtttgcggccgatgcctgtgctc
atggtctcaacgctcaccgcgcgcggctcagacatcacattagaagcgttggagttaggg
gcggttgactatgtcaccaaacccgtaggtgacccggagcatggtttgcagcgattggcc
ggtgagattgtacagaagctcaaggcctgtgcccgcgcaaatatcaccgcaattgagcac
aatgccaagcaacatcagttcagtgaagtccgggtagtgaagcccgacccggcagccgtg
aacccttttgatgttattgtcattggcgcctcaactggcggtacagaggcgattaaagag
attttatgcagtttgcccatgggcatgccgccggtagttctggtgcagcatctgccgcca
aagtttgcagaaaactttgccaggcgattaggtgtgattacggctttccaggtgatggcg
gtcagcgaaggtatcgttggattacagcagaatacggtctacctggcggggggagattgg
catcttgaaattaaccggtgtgctacaggtcgtataggcctgaaagtgtcagatacggcc
aaagtcaatcggcaccggccatcggtggacgtactgtttaactcagtcgccgaacatgta
aaagaccgggcgatcggtgtgctgttgaccggtatgggtatggacggagcggcaggcctt
ggccggatgcgttcagccggggcctatacactggcacaggataaggactcctgtgtcgtg
tggggtatgccccgcgtagcgatggagcagggcgcagtagaggaggtgaagccattgtgc
gaaatggccggacgtttggtgcagctttgtttcgggcgtcgtagtggttag

DBGET integrated database retrieval system