KEGG   Simiduia agarivorans: M5M_00430Help
Entry
M5M_00430         CDS       T02281                                 

Definition
Chemotaxis response regulator protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
saga  Simiduia agarivorans
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:saga00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    M5M_00430
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    M5M_00430
Enzymes [BR:saga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     M5M_00430
Two-component system [BR:saga02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   M5M_00430
Bacterial motility proteins [BR:saga02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    M5M_00430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
94046..95116
Genome map
AA seq 356 aa AA seqDB search
MKQISVIVVDDSRLVRELLTEIINADPVLNVVACAEDAYQARELIKLHNPQVITLDVEMP
GMNGIAFLKNLMRLRPMPVLMVSTLTARGSDITLEALELGAVDYVTKPVGDPEHGLQRLA
GEIVQKLKACARANITAIEHNAKQHQFSEVRVVKPDPAAVNPFDVIVIGASTGGTEAIKE
ILCSLPMGMPPVVLVQHLPPKFAENFARRLGVITAFQVMAVSEGIVGLQQNTVYLAGGDW
HLEINRCATGRIGLKVSDTAKVNRHRPSVDVLFNSVAEHVKDRAIGVLLTGMGMDGAAGL
GRMRSAGAYTLAQDKDSCVVWGMPRVAMEQGAVEEVKPLCEMAGRLVQLCFGRRSG
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagatcagtgtcatagtagtagacgattctcgcctggtccgtgaactgttgacc
gaaatcataaacgctgatccagtgttgaatgtagttgcctgtgcagaagacgcttaccaa
gcgcgagaactcattaagctgcacaatccgcaggttataacgctcgatgtggaaatgccc
ggcatgaatgggattgcgtttctcaaaaacctgatgcgtttgcggccgatgcctgtgctc
atggtctcaacgctcaccgcgcgcggctcagacatcacattagaagcgttggagttaggg
gcggttgactatgtcaccaaacccgtaggtgacccggagcatggtttgcagcgattggcc
ggtgagattgtacagaagctcaaggcctgtgcccgcgcaaatatcaccgcaattgagcac
aatgccaagcaacatcagttcagtgaagtccgggtagtgaagcccgacccggcagccgtg
aacccttttgatgttattgtcattggcgcctcaactggcggtacagaggcgattaaagag
attttatgcagtttgcccatgggcatgccgccggtagttctggtgcagcatctgccgcca
aagtttgcagaaaactttgccaggcgattaggtgtgattacggctttccaggtgatggcg
gtcagcgaaggtatcgttggattacagcagaatacggtctacctggcggggggagattgg
catcttgaaattaaccggtgtgctacaggtcgtataggcctgaaagtgtcagatacggcc
aaagtcaatcggcaccggccatcggtggacgtactgtttaactcagtcgccgaacatgta
aaagaccgggcgatcggtgtgctgttgaccggtatgggtatggacggagcggcaggcctt
ggccggatgcgttcagccggggcctatacactggcacaggataaggactcctgtgtcgtg
tggggtatgccccgcgtagcgatggagcagggcgcagtagaggaggtgaagccattgtgc
gaaatggccggacgtttggtgcagctttgtttcgggcgtcgtagtggttag

DBGET integrated database retrieval system