KEGG   Simiduia agarivorans: M5M_00605Help
Entry
M5M_00605         CDS       T02281                                 

Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
saga  Simiduia agarivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    M5M_00605
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M5M_00605
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    M5M_00605
Enzymes [BR:saga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     M5M_00605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
134032..134841
Genome map
AA seq 269 aa AA seqDB search
MNRINQRLSQLKAEGRKALVTYIVNGDPVPGATLATMHALVAAGADIIELGVPFSDPMAD
GPVIQLGHERALAHNTSLRDTFAVVQAFRDTNRDTPVVLMGYANPVVRMGYDAVAKAAKQ
AGVDGFLTVDLPPEEAADFNQVLKASELENIFLLAPTTQDDRIAHVAELASGFLYYVSLK
GVTGAGHLDVASVTEKTAQIRRHTPLPLCVGFGIKDADSAKAVAKVADGVVVGSLLVARM
GDLASESVDTIASQTAGLIAPMRAALDSL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaattaatcaacgtctctcccaactgaaggcggagggccgaaaagcactggtc
acctatatcgtcaatggcgacccggtaccgggcgccacactggctaccatgcacgcgctg
gtggcggccggggcggacatcatcgagctgggtgtgccattttccgatccgatggcggat
ggcccggtaattcagctgggccatgagcgcgcgctggcgcataacaccagcctgcgcgat
acctttgccgtggtgcaagccttccgcgacactaaccgggacacgccagtggtgctgatg
ggctatgccaacccggtggtgcgcatgggctatgacgccgtggccaaagccgcgaaacag
gcgggcgtggatggctttctgacggtcgatctgccaccggaagaggccgctgattttaac
caggtgctgaaagcctctgagttggaaaacattttcttgctggcacccactacccaggat
gaccgtatcgcccatgtggccgagttggcatcgggattcctctattatgtgtcactcaaa
ggtgtcactggcgctggtcacctggacgtggcctcggtgaccgagaaaaccgcccagatc
cgccgtcacaccccgctgcccctgtgcgtgggattcggtatcaaggatgccgattcagcc
aaagcagtggccaaggtggccgatggcgtggtggttggtagccttctggtggccagaatg
ggtgatttggccagcgaaagtgtggatactatcgcctctcaaaccgcaggtctgattgcg
cccatgcgcgcagcgctcgacagcctgtaa

DBGET integrated database retrieval system