KEGG   Simiduia agarivorans: M5M_00605Help
Entry
M5M_00605         CDS       T02281                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
saga  Simiduia agarivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:saga01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:saga00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:saga00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
134032..134841
Genome map
AA seq 269 aa AA seqDB search
MNRINQRLSQLKAEGRKALVTYIVNGDPVPGATLATMHALVAAGADIIELGVPFSDPMAD
GPVIQLGHERALAHNTSLRDTFAVVQAFRDTNRDTPVVLMGYANPVVRMGYDAVAKAAKQ
AGVDGFLTVDLPPEEAADFNQVLKASELENIFLLAPTTQDDRIAHVAELASGFLYYVSLK
GVTGAGHLDVASVTEKTAQIRRHTPLPLCVGFGIKDADSAKAVAKVADGVVVGSLLVARM
GDLASESVDTIASQTAGLIAPMRAALDSL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaattaatcaacgtctctcccaactgaaggcggagggccgaaaagcactggtc
acctatatcgtcaatggcgacccggtaccgggcgccacactggctaccatgcacgcgctg
gtggcggccggggcggacatcatcgagctgggtgtgccattttccgatccgatggcggat
ggcccggtaattcagctgggccatgagcgcgcgctggcgcataacaccagcctgcgcgat
acctttgccgtggtgcaagccttccgcgacactaaccgggacacgccagtggtgctgatg
ggctatgccaacccggtggtgcgcatgggctatgacgccgtggccaaagccgcgaaacag
gcgggcgtggatggctttctgacggtcgatctgccaccggaagaggccgctgattttaac
caggtgctgaaagcctctgagttggaaaacattttcttgctggcacccactacccaggat
gaccgtatcgcccatgtggccgagttggcatcgggattcctctattatgtgtcactcaaa
ggtgtcactggcgctggtcacctggacgtggcctcggtgaccgagaaaaccgcccagatc
cgccgtcacaccccgctgcccctgtgcgtgggattcggtatcaaggatgccgattcagcc
aaagcagtggccaaggtggccgatggcgtggtggttggtagccttctggtggccagaatg
ggtgatttggccagcgaaagtgtggatactatcgcctctcaaaccgcaggtctgattgcg
cccatgcgcgcagcgctcgacagcctgtaa

DBGET integrated database retrieval system