KEGG   Simiduia agarivorans: M5M_01175Help
Entry
M5M_01175         CDS       T02281                                 

Definition
glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
saga  Simiduia agarivorans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    M5M_01175
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    M5M_01175
Enzymes [BR:saga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     M5M_01175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
255591..256610
Genome map
AA seq 339 aa AA seqDB search
MTVGVVMLDVAGLALTPYDKALLKNPQVGGLILFSRNYRDREQLMALVTSIRACSPDIVI
AVDHEGGRVQRFRDGFTRIPAMQSFLPAYRTAPAATLARVRDVGWLMASELLACGIDISF
APVLDVDDHHCQVIADRAFSPDPSEVVVLAGAFMDGMHEAGMATTGKHFPGHGSVTGDSH
LVQPIDDRPLAQVTAHDLIPFARLAPKLDAVMPAHIVFSQVDDQPVGFSAHWLKTVLRGQ
LNFNGVIFSDDLSMAGAESAGSYAARADAALKAGCDMVLVCNQREAAQEVVQHLSELAQP
GSERLPAMRARKRCHWQDLHDNPRWQRMAAELSPETMEG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacggttggtgttgtcatgctcgacgtggcgggccttgcgcttacgccgtacgataaa
gccctgctgaaaaatcctcaggttggcggcttgatcctgttttcccgcaattaccgcgac
cgtgagcagctcatggcgctggttacctcaatccgtgcttgcagtccggacattgtgatc
gctgtggaccatgagggtgggcgcgtgcagcggtttcgcgacggctttacccggattccc
gctatgcaaagctttttgcccgcctaccggacggcgccggcagcgacacttgcgcgagtg
cgcgatgtgggctggctgatggcgagtgaattactggcgtgcgggatcgatatcagtttc
gcaccggtgctggatgtggatgaccatcactgtcaggtcattgccgatcgcgcgttttcg
cccgaccccagtgaggtggttgtgctggcaggagcgtttatggatggcatgcatgaagcg
ggtatggcgaccacgggcaagcattttcctggccatggctctgtaaccggcgacagtcat
ttggtccagccgatagacgacaggcccctggcacaagtgaccgcgcatgatttgattcct
tttgcccggcttgcaccaaagctggacgccgttatgcctgcacatatcgttttcagtcag
gtggatgaccagccagtgggattttccgcgcattggttaaaaaccgttttgcgcgggcag
ttgaatttcaatggggtcattttcagcgatgacttgtcaatggctggtgccgagagtgcg
ggcagctatgccgcgcgcgcggatgccgcgttgaaggcgggctgtgacatggtgttggtg
tgcaaccagcgcgaggcggcgcaggaagtggtgcagcatttgtccgagcttgctcaaccc
ggctctgaacgtttgcctgcgatgcgcgcgcgcaagcgctgtcattggcaggatcttcac
gataatccacgctggcagcgcatggctgccgaactttcacccgagactatggaaggctag

DBGET integrated database retrieval system