KEGG   Simiduia agarivorans: M5M_02540Help
Entry
M5M_02540         CDS       T02281                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
saga  Simiduia agarivorans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    M5M_02540
   00052 Galactose metabolism
    M5M_02540
   00500 Starch and sucrose metabolism
    M5M_02540
   00520 Amino sugar and nucleotide sugar metabolism
    M5M_02540
Enzymes [BR:saga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     M5M_02540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
566590..567468
Genome map
AA seq 292 aa AA seqDB search
MNNKPVTKAVFPVAGMGTRFLPATKAIPKEMLPIVDKPLIQYAVEEAYAAGIREMIFITG
YHKRSIEDHFDSAYQLESELEIANKLELLDTVRSVKPDDMECVYIRQPKALGLGHAICCA
ERLINDEYFAVLLADDLMVGEGKPILAQMVDVYHQTGGSVMATQDVPREETYKYGILDVA
GSAEQTARIVGMIEKPAVEDAPSTLAVSGRYVLSSSVFGYIKSQPKGKGGEIQLTDGIAA
MLKDEGVYSYRYNGRRYDCGSKEGYVKATIDMALASNGLSAATREHINSLNI
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaacaataaacccgtcaccaaagccgtatttcccgtcgctggcatgggcacccgcttt
ttacccgcaaccaaggcgattccgaaggaaatgctgcctattgtggataagcctttgatc
caatatgcggttgaagaggcttatgccgccggcattcgtgaaatgatatttattaccggc
tatcacaagcggtcgattgaagaccattttgatagcgcctatcagctagaatcggaactc
gaaatcgccaacaagctagaacttctcgatacggttcgctctgtaaagccggatgatatg
gagtgtgtttatattcgtcagccaaaagccttggggttagggcatgctatatgttgtgcc
gagaggttgatcaatgatgaatattttgccgtgctgcttgcggacgatttaatggtagga
gaaggcaaaccgattcttgctcaaatggttgatgtatatcatcagacgggcgggtcggtg
atggctacgcaggatgtgccacgcgaagaaacctataagtacggtattctggatgtagct
ggaagtgcggagcaaactgcgcgcatagtgggcatgatcgagaagcctgccgttgaggac
gcgccttctaccttggcagtatccggtcgttatgttctgtcatccagcgtgttcgggtac
atcaaatcccagcctaaaggtaagggcggagaaattcagctcaccgacggcatagccgcc
atgttgaaagatgaaggtgtttattcgtatcgctacaacggtcgccgctatgattgcggc
agtaaggaaggctacgtaaaggccactatcgatatggcattggcaagtaacggtttgtct
gcggcaacgcgtgagcatataaatagtcttaatatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system