KEGG   Simiduia agarivorans: M5M_02710Help
Entry
M5M_02710         CDS       T02281                                 

Definition
(GenBank) protein RfbC2
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
saga  Simiduia agarivorans
Pathway
saga00521  Streptomycin biosynthesis
saga00523  Polyketide sugar unit biosynthesis
saga01130  Biosynthesis of antibiotics
Module
saga_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    M5M_02710
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    M5M_02710
Enzymes [BR:saga01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     M5M_02710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: AFU97759
UniProt: K4KFC0
Position
599925..600473
Genome map
AA seq 182 aa AA seqDB search
MEFESLAIPEVVVIRPKVYSDARGFFMETFRQELFERYCGAYQFVQDNHSRSSQGILRGL
HYQLEQPQGKLVRVTKGEVFDVAVDLRKSSPTFGHWVGRTLNEDNKELMWVPPGFAHGFY
VISETADFQYKCTDYYAPHDEKVLLWSDPDLAIDWPLLSEHPLMSEKDLQGSLLENCITY
GC
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggaatttgaatcactagctataccagaggtcgtagtgatacggcccaaggtctattca
gatgcgcgcggttttttcatggaaacctttcgtcaggaactttttgagcggtactgcggt
gcctatcaatttgttcaggacaaccacagtagatcttcacaagggattctgcgcggcctt
cactatcaattggagcagccccaaggcaagcttgttcgcgtaactaaaggtgaagttttt
gatgtggcggttgacctccgaaagtcttcgccaacttttgggcattgggtaggcaggacg
ctcaatgaggacaataaagaactgatgtgggtgcctcctgggtttgcccatggattttat
gtgatcagcgaaactgcggattttcagtacaaatgtacagactattatgcgccgcatgat
gaaaaagttttgctctggagtgaccctgatttggccattgattggcctttgttatcggaa
catcctctaatgtcagagaaagacttgcaaggctctttgcttgaaaactgtattacctat
ggatgctag

DBGET integrated database retrieval system