KEGG   Simiduia agarivorans: M5M_03190Help
Entry
M5M_03190         CDS       T02281                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
saga  Simiduia agarivorans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M5M_03190
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    M5M_03190
   00630 Glyoxylate and dicarboxylate metabolism
    M5M_03190
Enzymes [BR:saga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     M5M_03190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(705095..707269)
Genome map
AA seq 724 aa AA seqDB search
MAKRVEHSGLQIAESLYRLVADEIAPGTGVEPAAFWDSLAGILKSFAPRNQALLAKRDDL
QAKIDQWHLDNPGAIRDMGAYKRFLTDIGYLEAEPEDFAITTTNVDDEIALQAGPQLVVP
VKNARFALNAANARWGSLYDALYGTDAISEEGGAERAGGYNPARGAKVIAFARAHLDQAA
PLAAGSHAEATAYKVSFGELRVLLESGTEVGLAQPEKFVGYRGAESSPDAILLKNNALHI
EIQIDPNSPIGKTDKAGVKDLLVEAAITTIMDCEDSVAAVDAEDKVEVYANWLGLMKGNL
QETFQKGSQTVTRQLNPDRIYTAAKGGELSLHGRSLLFVRNVGHLMTTDAVLDANGNEIP
EGILDGMVTVLAAKHDLLNTAPISNSRTGSVYIVKPKMHGPEEVAFTCDLFAAIESALAL
PALTLKVGIMDEERRTTVNLKKCIQVAKDRVVFINTGFLDRTGDEIHTSMLAGPFVPKSE
MKQQAWINAYEDANVDIGLACGLAGKAQIGKGMWAMPDEMAAMLAQKSGHPKSGANTAWV
PSPNGATLHSTHYHQINVRDRQLEILKRTPASLDAILTVPVMADGVKLTDAQVQRELDNN
VQGILGYVVRWIDQGVGCSKVPDINNIGLMEDRATLRISSQHIANWLHHGICSEAQVKAT
FERMAGVVDRQNAGDPAYITMADKLEKSIAYKAALALVLEGKAQPNGYTEPLLHSYRKQF
KAAH
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggccaagagagttgaacacagtggattgcaaatcgcagagtcattgtaccgcttggtt
gcagatgaaatcgcgccgggcacgggtgttgagcccgctgcattctgggattctttggcc
ggtatcctgaagtcttttgcgccccgtaaccaggcattgctggcaaagcgcgacgacttg
caggccaagattgaccaatggcatctggacaatcccggtgccattcgcgatatgggcgcc
tacaagcggtttttaactgatataggttatctcgaagccgagccggaagactttgccatt
actaccaccaatgtggatgacgagatcgcgcttcaggcaggccctcaattagtggtaccc
gttaagaatgcgcgtttcgcattgaatgcagcgaatgcccgttgggggagcctgtacgat
gcgctctatggcaccgatgcgatcagtgaagagggcggcgctgagagggccgggggctac
aaccccgcgcgcggtgctaaggttattgcctttgcgcgcgcccaccttgatcaggctgcc
cctttggctgccggcagtcatgcggaggcgacggcctataaagttagctttggagagctc
cgggttttactggagagcgggaccgaagtgggcttggcgcagccggaaaaatttgttggc
taccgcggcgctgaatcaagcccggatgccatattgctcaaaaacaacgcgcttcacatt
gaaatccagattgaccccaactctccgattggcaagaccgacaaggccggtgttaaggac
ctgttggtagaagcggccattaccaccattatggattgcgaggattcggtggcggcggtc
gatgcggaagataaggtagaggtctatgccaattggctcggcctgatgaaaggcaatttg
caggaaacattccagaagggcagtcaaaccgttacccgtcagctgaacccggatcgcatt
tacactgcagcaaaaggtggtgagctgagcttgcatggccgcagcttgctgtttgtgcgt
aacgtcgggcatctgatgactactgacgctgtgttggatgccaatggcaatgaaatcccg
gaaggcattctggatggtatggtcactgtattggcggctaaacatgatttgcttaatacg
gcgccgatcagtaactcgcgcactggcagtgtgtacattgtaaaaccaaaaatgcacggc
cccgaagaagttgcgtttacctgtgatctatttgccgcaatcgaatcagcgcttgcctta
ccggcactgacattgaaggtcggcatcatggatgaagagcggcgtacaacggtcaacctg
aaaaagtgtattcaggtggcaaaggatcgcgtggtatttattaacactggtttcctcgat
cgcaccggtgacgaaattcacaccagcatgctggcaggcccttttgttccaaaaagtgaa
atgaagcagcaggcctggattaatgcctatgaagatgcgaacgtggatatcggtcttgct
tgtgggctggccggcaaggcgcagattggtaagggcatgtgggcaatgccggacgaaatg
gctgccatgttggcgcaaaaatccggtcaccctaaatccggtgcgaatactgcctgggtg
ccttcgccaaacggtgccacgttacactccacccattaccatcagatcaatgtccgggat
cgacagctggaaatcctgaagcgcacgcctgcatccctggatgccattctgacggttccc
gtgatggctgacggcgttaaactgacggatgctcaggtgcagcgcgagttggacaacaat
gtgcaggggatccttggttacgtggtgcgctggattgaccagggcgtcggttgttccaag
gtgccagatatcaataacatcgggttgatggaggatcgtgcaacgttgcgaatttccagt
cagcatattgccaactggctgcatcatggcatttgtagtgaagcgcaggttaaagcaacg
tttgagcgtatggccggcgtcgttgatcggcagaacgcgggcgatcctgcctacatcacc
atggcagataagctggaaaagagcattgcttacaaagcggcgctcgccctggtattggag
ggcaaagcccagcccaatggttacaccgagccactgttgcacagctaccggaaacaattt
aaagcagctcactaa

DBGET integrated database retrieval system