KEGG   Simiduia agarivorans: M5M_03200Help
Entry
M5M_03200         CDS       T02281                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
saga  Simiduia agarivorans
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M5M_03200
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    M5M_03200
Enzymes [BR:saga01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     M5M_03200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
708611..710206
Genome map
AA seq 531 aa AA seqDB search
MSQYTNDIAAIAKLRDTQGSKWEAINPEYAARMRAQNRFKTGLDIAKYTAKIMREDMAAY
DANTAEYTQSLGCWHGFIGQQKLIAIKKHLGNTKRRYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVAALIEELYTFLRQADARELGGLFRQLDEARAQDDQAKAKEIQSKIDNFETHVVP
IIADIDAGFGNEEATYLLAKKMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHADFLAKI
RAVRYAFLELGVEDGVIVARTDSLGAGLTKQIAVTKEPGDLGDLYNSFLDAEEVDAADMK
NGDVIINRNGKLLRPKRLASGLFQFRKGTGEDRVVLDCITSLQNGADLLWIETEKPHVGQ
IAAMVNRIKEVVPDAKLVYNNSPSFNWTLNFRQQVFDAWKEAGKDVSAYDRANLMSEEYD
NTELSKEADARIQTFQKDGSREAGIFHHLITLPTYHTAALSTDNLAKGYFGEQGMLAYVE
GVQRKEIRQGIACVKHQNMAGSDMGDDHKEYFSGDAALKASGKDNTMNQFG
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaatacaccaacgacattgccgcaattgccaagctgcgcgacacccagggcagc
aagtgggaagcaatcaatccagaatacgccgcacgtatgcgcgcccagaaccgctttaaa
accggtctggatatcgccaagtacacggccaaaatcatgcgtgaagacatggcagcctac
gatgccaataccgctgagtacacccaatcgctgggttgctggcacggtttcatcggccag
caaaagctgatcgcgatcaaaaaacacctgggtaataccaagcgccgctacctgtacctg
tccggttggatggttgccgcactgcgcagcgaattcggccctctacccgaccagtcaatg
cacgaaaagacttcggtagcggcactgattgaagagctctacaccttcctgcgtcaggcc
gatgcacgcgaactgggcggtctgttccgccagctggacgaagcccgcgcccaggatgat
caggccaaggccaaagaaatacagagcaagattgacaacttcgaaacccacgttgtgccg
atcattgccgatatcgatgcaggctttggtaacgaagaagccacttacctgctggccaag
aaaatgatcgaagctggtgcttgctgcattcagatcgaaaaccaggtgtctgacgagaag
caatgtgggcatcaggacggcaaggtgaccgtaccgcacgccgacttcctggccaaaatc
cgcgctgtgcgttacgccttccttgagttgggcgtagaagacggcgtgatcgttgcccgc
accgactccctgggcgccggcctgaccaagcaaatcgccgtcaccaaagagccgggcgat
ctgggcgacctgtacaacagcttcctggatgcagaagaagttgatgcagccgacatgaaa
aatggcgatgtcatcatcaaccgcaatggtaagttgctgcgacccaagcgcctggcctcc
ggcctgttccaattccgcaagggcaccggcgaagaccgtgtggttctggattgcatcact
tctctgcaaaacggcgccgacctgttgtggatcgagaccgaaaagccacacgttggccag
attgcagccatggtaaaccgcatcaaagaagtggtacccgacgccaagctggtgtacaac
aactcgccgtcgttcaactggacgctgaacttccgccagcaagtattcgatgcgtggaaa
gaggctggcaaggacgtgtctgcttacgatcgcgccaacctgatgagcgaagaatacgac
aacaccgagctttccaaagaagccgatgcccgtatccagacgttccagaaagatggttca
cgtgaagccggcattttccaccacctgatcacactgcccacctaccacaccgcggccctg
tctactgacaacctggccaaaggttacttcggtgagcagggtatgctggcctacgttgaa
ggcgtacagcgcaaagaaatccgccagggcattgcctgtgttaaacaccagaacatggca
ggctctgatatgggcgacgatcacaaagagtacttctctggcgacgcagccctgaaggcc
tcaggtaaagacaacaccatgaaccagtttggttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system