KEGG   Simiduia agarivorans: M5M_03430Help
Entry
M5M_03430         CDS       T02281                                 

Definition
acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
saga  Simiduia agarivorans
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    M5M_03430
Enzymes [BR:saga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     M5M_03430
   3.1.2  Thioester hydrolases
    3.1.2.-  
     M5M_03430
Lipid biosynthesis proteins [BR:saga01004]
 Fatty acid synthase
  Component type
   M5M_03430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
756466..757071
Genome map
AA seq 201 aa AA seqDB search
MKWFLSLLAGLLLSVSVSAEPAPRLLVLGDSLSAGYGLEHPDQGWVSLMAQDLKNDYKVI
NASISGDTTAGGLARLPALLDKYSPEILIIELGGNDGLRGYSLATLRQNLSQMVSLGQAA
GAEVVVMEIQIPPNYGKRYTEKFTAIFSQVAADKNARLIPFFLTELALVDGMMQADGIHP
TAAAQNTMKDQVLDALQLAQR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttcttatcattgctcgcgggcttgctgctgtctgtctcagtttcagcggaa
ccagccccccgcctgttagtactgggtgacagcctgagtgccggctatggtcttgaacac
ccggatcagggctgggtctcgctgatggcacaggatctgaaaaatgattacaaggtgatc
aatgccagcatcagtggcgacaccaccgcgggtggccttgcccgtctgccggctttgctg
gataaatattcgcccgagatactgatcatcgaattgggtggcaacgatggcttgaggggt
tactcactggcaaccctgcgccaaaacctctcccagatggtcagcctgggccaagccgct
ggtgccgaggtggtcgttatggaaatccagattccacccaattacggcaagcgttataca
gaaaaatttaccgcgattttcagtcaggtggcggccgacaaaaacgctcgcttaatccct
tttttcctcacagaactggcactggttgacggcatgatgcaagccgacggcattcacccc
accgcggcggcgcaaaacaccatgaaagaccaggtgctggacgcccttcaactggcgcag
aggtaa

DBGET integrated database retrieval system