KEGG   Simiduia agarivorans: M5M_03450Help
Entry
M5M_03450         CDS       T02281                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
saga  Simiduia agarivorans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    M5M_03450
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M5M_03450
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    M5M_03450
Enzymes [BR:saga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     M5M_03450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(759983..761377)
Genome map
AA seq 464 aa AA seqDB search
MKYISTRGQAPALSFEDAVLTGLASDGGLYVPENLPQFSKDTIAGWAGLSYDALAFEVIK
PFVAGALTDEELRTIIQKAYSSFRHQAIAPLVQTGHNEWILELFQGPTLAFKDFALQFLG
HLLDHILARRKQKVVVMGATSGDTGSAAIEGCSRCENIDIFILHPHNRVSEVQRRQMTTV
LSDNVYNIALEGNFDDCQNMVKASFADQSFLPDGRQLVAVNSINWARIMAQIVYYFYAAV
ALGAPHRAVSFSVPTGNFGDIFAGYLARKMGLPVEQLIVATNANDILHRCISANDHSKKP
LIHSLSPSMDIMVSSNFERLLFDLYGRDGKAIAELMASFKSGSMTLSESALQKAREVFSS
YRLDDETMTKVIAGVYDTTGYLLDPHTAIGVEAARKCRANVSTPMVCLATAHPAKFPKAV
AKAGVTDTPALPHHMADLFDREERYQVLANDLAGVHQYISGQLS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatacatcagtacccgcgggcaagcgcccgcgttgtctttcgaagacgctgtgctt
accgggcttgccagtgatggcggcttgtatgtgccggagaatttaccccagttcagtaaa
gacactattgccggctgggccggtttatcctacgacgccctggcgtttgaggtgatcaag
ccatttgtggcaggcgctttgaccgacgaagagctgcgtaccattatccagaaggcctat
agcagttttcgccaccaggctatcgcgcctttggtacagaccgggcacaacgaatggatc
ttggaattgtttcaggggccaacgctggcgtttaaggatttcgcactgcagtttttggga
catctgctcgaccacattctcgcccgccgcaaacagaaggtagtggtgatgggtgcgacc
tcgggggataccggttcggccgcgattgaaggttgctcgcgctgtgaaaatatcgatatc
ttcatactgcacccccataatcgcgtcagtgaagtgcagcgccgtcagatgacgacggtt
ctgagtgacaatgtgtataacatcgcgctggaaggcaatttcgatgattgtcagaatatg
gtgaaggccagttttgccgatcaatctttcctgcccgatggccggcaattggtggcagtg
aattccatcaactgggcgcggatcatggctcagattgtgtactatttttacgccgccgtc
gctttgggtgcaccgcaccgggcagtctcgttttcagtgcctactggtaactttggcgac
atctttgcgggctacctggcgcggaaaatggggctgcccgttgaacagttgattgtggcc
acaaacgccaacgacatactgcaccgctgtatcagcgcaaatgatcacagcaaaaagcca
ttgatacacagtctgtcgccaagcatggatattatggtgtccagtaacttcgaacgttta
ttgtttgatctctatgggcgggatggcaaggccatcgcagaactgatggcgtcgtttaag
tcaggcagtatgaccctgtccgagtctgcgttgcagaaggcgagagaagtattcagcagt
tatcgccttgatgatgaaaccatgaccaaggtaattgctggtgtttacgacacgaccggc
tatttgctcgacccgcatactgccattggcgtcgaggctgcgcgcaagtgccgtgcaaat
gtttcaacgccgatggtgtgtctggccacggcccatccagcgaaatttcccaaagcggtc
gctaaagcgggcgttaccgatacgcccgctttaccacaccacatggccgatcttttcgac
agagaagagcgctaccaggtgttggcgaatgacctggccggcgtccatcagtatatcagc
ggacaattgagctaa

DBGET integrated database retrieval system