KEGG   Simiduia agarivorans: M5M_03450Help
Entry
M5M_03450         CDS       T02281                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
saga  Simiduia agarivorans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    M5M_03450
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    M5M_03450
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    M5M_03450
Enzymes [BR:saga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     M5M_03450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(759983..761377)
Genome map
AA seq 464 aa AA seqDB search
MKYISTRGQAPALSFEDAVLTGLASDGGLYVPENLPQFSKDTIAGWAGLSYDALAFEVIK
PFVAGALTDEELRTIIQKAYSSFRHQAIAPLVQTGHNEWILELFQGPTLAFKDFALQFLG
HLLDHILARRKQKVVVMGATSGDTGSAAIEGCSRCENIDIFILHPHNRVSEVQRRQMTTV
LSDNVYNIALEGNFDDCQNMVKASFADQSFLPDGRQLVAVNSINWARIMAQIVYYFYAAV
ALGAPHRAVSFSVPTGNFGDIFAGYLARKMGLPVEQLIVATNANDILHRCISANDHSKKP
LIHSLSPSMDIMVSSNFERLLFDLYGRDGKAIAELMASFKSGSMTLSESALQKAREVFSS
YRLDDETMTKVIAGVYDTTGYLLDPHTAIGVEAARKCRANVSTPMVCLATAHPAKFPKAV
AKAGVTDTPALPHHMADLFDREERYQVLANDLAGVHQYISGQLS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatacatcagtacccgcgggcaagcgcccgcgttgtctttcgaagacgctgtgctt
accgggcttgccagtgatggcggcttgtatgtgccggagaatttaccccagttcagtaaa
gacactattgccggctgggccggtttatcctacgacgccctggcgtttgaggtgatcaag
ccatttgtggcaggcgctttgaccgacgaagagctgcgtaccattatccagaaggcctat
agcagttttcgccaccaggctatcgcgcctttggtacagaccgggcacaacgaatggatc
ttggaattgtttcaggggccaacgctggcgtttaaggatttcgcactgcagtttttggga
catctgctcgaccacattctcgcccgccgcaaacagaaggtagtggtgatgggtgcgacc
tcgggggataccggttcggccgcgattgaaggttgctcgcgctgtgaaaatatcgatatc
ttcatactgcacccccataatcgcgtcagtgaagtgcagcgccgtcagatgacgacggtt
ctgagtgacaatgtgtataacatcgcgctggaaggcaatttcgatgattgtcagaatatg
gtgaaggccagttttgccgatcaatctttcctgcccgatggccggcaattggtggcagtg
aattccatcaactgggcgcggatcatggctcagattgtgtactatttttacgccgccgtc
gctttgggtgcaccgcaccgggcagtctcgttttcagtgcctactggtaactttggcgac
atctttgcgggctacctggcgcggaaaatggggctgcccgttgaacagttgattgtggcc
acaaacgccaacgacatactgcaccgctgtatcagcgcaaatgatcacagcaaaaagcca
ttgatacacagtctgtcgccaagcatggatattatggtgtccagtaacttcgaacgttta
ttgtttgatctctatgggcgggatggcaaggccatcgcagaactgatggcgtcgtttaag
tcaggcagtatgaccctgtccgagtctgcgttgcagaaggcgagagaagtattcagcagt
tatcgccttgatgatgaaaccatgaccaaggtaattgctggtgtttacgacacgaccggc
tatttgctcgacccgcatactgccattggcgtcgaggctgcgcgcaagtgccgtgcaaat
gtttcaacgccgatggtgtgtctggccacggcccatccagcgaaatttcccaaagcggtc
gctaaagcgggcgttaccgatacgcccgctttaccacaccacatggccgatcttttcgac
agagaagagcgctaccaggtgttggcgaatgacctggccggcgtccatcagtatatcagc
ggacaattgagctaa

DBGET integrated database retrieval system