KEGG   Simiduia agarivorans: M5M_03460Help
Entry
M5M_03460         CDS       T02281                                 

Definition
protein-disulfide isomerase DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
saga  Simiduia agarivorans
Brite
Enzymes [BR:saga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     M5M_03460
Secretion system [BR:saga02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   M5M_03460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(762874..763638)
Genome map
AA seq 254 aa AA seqDB search
MLKPMLIAMGIGLALASGQVTAQLAPSALPVSPDVEAHLKRKIGAAIPHMAVTGIQPGPF
PGIYAVSLSNGPTLYTDAKGDMLVAGDLYSIKGQKLVNVRELELQKVRKPMLASLNKDDM
IVFPAEGKQKGAIYIFTDVDCGYCRKLHQEVPALNKAGVEVRYLAYPRAGIASESYNKLA
HAWCADDPNATLTRLKQGQQVSGTVCSDNPIAAQYQLGAEMGVGGTPAIFLESGEMIPGY
KPAPELLKMLGIDS
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagcctatgttgattgccatgggaatcggtcttgctctggcgtcaggacaggta
acagcccagctcgcgccttcggcgttgcccgtatcacctgacgttgaagcgcatctcaag
cgcaagattggtgctgcgattccacatatggcagtcactggtatacaacctgggcctttc
ccgggtatctatgccgtttccctgtccaatggtccgaccctgtacacggacgcaaagggc
gatatgttggttgccggtgatctttacagcatcaaaggtcagaaactggtcaacgtccgg
gagctggagctgcaaaaagtacgcaaacccatgttggcctcgcttaataaggacgacatg
attgtgttccccgccgaaggaaagcaaaaaggggcaatctatattttcacggatgtggat
tgcggttattgtcggaagctgcaccaggaggtgccggcgctgaacaaagcgggcgttgag
gtaaggtatctggcgtacccccgcgccggtatcgccagtgaatcctataacaaattggct
cacgcctggtgtgccgatgaccccaatgccaccctgacccgactcaagcaggggcagcag
gtaagcggcactgtctgctcagacaatccgattgctgcccaataccagctgggagcggag
atgggggtaggtggtacgcctgctatttttcttgaatctggtgaaatgattcccggctat
aaacctgctccagagttgctgaagatgcttggcatcgattcctga

DBGET integrated database retrieval system