KEGG   Simiduia agarivorans: M5M_03580Help
Entry
M5M_03580         CDS       T02281                                 

Definition
D-cysteine desulfhydrase (EC:4.4.1.15)
Organism
saga  Simiduia agarivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(787754..788818)
Genome map
AA seq 354 aa AA seqDB search
MLNPANTLVYPARMALAHAPTPLQPLSRIARHVGFDGGLWIKRDDLTGSHLSGNKIRKLE
FLVAEAKSQNADVLITCGGVQSNHCRATALLAAQLGMRCHLLLRGEEPAEKDGNVLLDCL
SGASISYYPSAGFQRNLDSYFKHWQAYYAEQGLRAYGIPTGGSNGTGLWGYIAGTEELHG
QCVSQGLVPSHIVTATGSGGTQAGLTLGSALTGLGCKVLGMAVCDDAAWFNRKVAEDMAE
WFQQFTPLAERNLEVAGVSLSDLQAITLDNYVGPAYAVADPDVFETIQLAASLEGLVLDP
VYTGKAFHGLLQELRAGSLRHARDVVFVHTGGIFGVFPQRAQFAFNNNNGETKK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatccggccaacacacttgtctatccggcgcgcatggcattggctcatgcgccc
acgcctctgcagccgttatcccgtatcgccaggcatgtcggttttgacggcgggctgtgg
attaaacgggatgatctcactggctcgcatctgagcggtaacaaaatccgcaagcttgaa
tttctggttgcagaggccaagtcacagaacgctgatgtgctgattacctgcggtggcgtt
caatccaatcactgcagagcaacggcgttgctggcagcacagctgggtatgcgatgccac
cttttattgcgcggagaagagcccgcggaaaaggacggcaatgtgttgctcgactgcttg
tcgggcgcgtcaatcagctactatccatcggcgggttttcagcgcaatctcgacagttat
ttcaagcactggcaagcctattacgccgaacaaggattgcgcgcttatggcattcccacg
ggtgggagcaatggcactggtctttggggctacattgcgggcaccgaagaattgcatggc
caatgtgtcagccaggggttggtgccaagccacattgtcaccgccaccgggtccggggga
actcaagccggcctgacgttgggttcggcgctgaccgggttgggttgcaaggtgctgggg
atggccgtatgtgatgacgcagcctggttcaaccgtaaagttgcagaagatatggccgag
tggtttcagcagttcacgcctttggctgagcgcaatctggaggtagccggcgtgagtctt
tcggatcttcaggcgattacattggacaactatgtgggacctgcctacgcagtggcagat
cctgacgtgtttgaaaccatccagctggcagcaagcctggaggggttggtgcttgatccc
gtctatacaggtaaggcgtttcacggcctgttgcaggaattacgtgctggcagcttgcgc
cacgcacgtgatgtggtattcgtgcatacgggtggcatctttggtgtgtttccacagcgg
gcacagttcgcgtttaacaataacaatggcgagactaaaaagtga

DBGET integrated database retrieval system