KEGG   Simiduia agarivorans: M5M_04355Help
Entry
M5M_04355         CDS       T02281                                 

Definition
glycosyl hydrolase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
saga  Simiduia agarivorans
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:saga00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:saga00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(941566..943938)
Genome map
AA seq 790 aa AA seqDB search
MINRTLLTAIALVLMLAGCGGDNTATKPAAVKQKLDSDFLLAEESVSAAIIPKPREMIRG
QGAFAINAGTRLVAHPDVQDLADYLRQQFSPATGYTFPLADASETQNVIRLELADVGSAN
GEAYKLSVSLSEIRISAASKAGLFWGVQSLRQLMPADIEINAPINRSQWLVPVLEIQDEP
AFSYRGMHLDVSRTFFPVEFIRQYIDLLALHKLNYLHWHLTDDQGWRIEIKAFPKLTSIG
AWRTATVVGHTYDRDGLYDNQSLGGFYTQAQIRELVAYAQARQVTIIPEIDIPGHASAIL
AAYPEFGCTGEMADVQSNFGVFPEVLCPTETTFAFLDQVFAEVAGLFPSPYIHVGGDEVK
TEQWQSCDSCNALMEREGLKDYMALQGYIIKRVEASINKLGKQIIGWDEILEGDVNPSAT
ITSWRGIEGAIHAAREGHDAIMAPGSHLYFDHYQSRSIDEPLAIHGLTPVSETYSFSVIP
EELAQDPAAKRILGAQGHLWTEYVRTPAKAQYMVLPRMSALAEVVWTDASQKSWPDFARR
LPKMFDRFEAAGLNYATSVYAVNAQIESVPDGFLVRLDSDMPDAVIRYTTDGSLPGINSP
VYREPIRVKAGLLRAKAQDPQTGRLFNERRITLVDHLARGAKVVLSTDADRAWNKQPEQT
LVDGVLSRDQIFQLDDWATFNEGGLVAELDLLQVKQLSLVNIGFNAGRFRHFYAPTKLTV
ELSEAGDVWQKVGELGQAKLAAESLSATVTFNTQAARYVRVTAENGAQRYSTEHRAPVPV
TLYFDEIIVK
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaatcgaacgttgttgacggctattgcactggtgttgatgctcgcaggctgcggc
ggagataacaccgcaacgaaaccagccgctgttaagcagaaactcgacagtgattttctg
ttggctgaagagagcgtgagtgctgcgatcattcccaagccgcgggaaatgattcggggg
cagggggcatttgcgatcaatgccggcacccgcctggttgctcaccccgatgttcaggat
ctggcagactatctgcgtcagcagttcagtcccgcaacaggctacacatttcccctggca
gatgcctctgagacccaaaatgtgatccggctggagctcgcggatgtggggtcagctaac
ggcgaggcttataaactgtccgtttccctgtcagaaatccgaatcagtgccgcgtccaag
gccggtctgttttggggcgttcaaagcctgcgccagttgatgcccgctgatattgaaatc
aatgccccgattaatcgatcccaatggttggtgccggtgctggagattcaggatgagccc
gccttttcgtaccggggtatgcatctggatgtgagccggacctttttccctgttgaattc
attcgtcagtatattgatttgctcgcactgcataagctgaactacctgcattggcatctg
accgatgatcagggctggcgcattgagatcaaagcgtttccaaaattgaccagcatcggc
gcctggcgcacggcaacggtggtcggccacacctatgatcgcgacgggctttatgacaat
caatcgctgggtggtttttatacgcaggcccagattcgcgagctggttgcttatgcgcag
gctcgtcaggttaccatcatcccggaaattgatattcccggtcacgcctcagccatattg
gcggcttatccggagtttggctgtactggtgaaatggccgacgtacaaagtaactttggc
gtatttcctgaagtgctttgtcccactgaaacgacgtttgcatttctggatcaggtcttt
gctgaagtggccgggctttttccttcaccttatattcacgtaggtggcgatgaggttaaa
accgaacagtggcagagttgtgatagctgcaatgcgctgatggagcgcgagggcctgaag
gactacatggctttacagggctatataatcaagcgggttgaagccagcattaacaagctc
ggaaagcaaatcattgggtgggatgaaatccttgaaggcgacgttaatccgtctgccacc
attacctcctggcgtggcattgaaggcgctatccatgcggccagagaagggcacgatgcc
attatggcacccgggtcgcatttgtactttgatcactaccagtcccgctcaatcgatgag
ccgctcgccattcatggcctgacgcctgtgagcgaaacctatagctttagcgtgattccg
gaagagctcgcacaggacccggcggccaaacgtattttgggtgcacaggggcatttgtgg
accgaatacgtcagaacacctgccaaagcccagtacatggtactgcctcgcatgagtgcg
ctggccgaagtagtgtggaccgatgcatcgcaaaaatcctggccggattttgcccgccgg
ctgcccaaaatgtttgatcgttttgaggcggctggtctcaactacgcgaccagtgtctat
gcggtcaatgcgcagattgaatcggtaccagacggctttctggtccgtctcgacagcgat
atgcccgatgcggtgatccgctacactaccgatggcagcctgcctggcatcaatagccct
gtataccgtgaacccattcgggtgaaagccggtctgcttagggcaaaagcgcaagacccg
caaaccggccggctgtttaatgaacggcgtatcaccctggtggatcatctggctcggggc
gccaaggttgtgttgagtactgacgctgaccgggcctggaacaagcagcctgagcagacc
ttggtcgatggtgtgttatcgcgcgaccagatattccagctggatgattgggccaccttt
aatgagggcgggttggtcgccgagttggatttactgcaggtcaaacagctgagtctggtc
aatatcggatttaacgcaggacgattccgtcatttttatgcgccgactaagttaaccgtt
gagctgagtgaagcgggtgacgtgtggcagaaggtgggcgagttgggtcaggccaagctg
gctgcagagtcactttctgcgaccgtaacatttaatactcaggcagcccgctatgtgcgt
gtaactgcagaaaacggtgcgcagcggtactcaaccgagcatcgcgccccggtgcccgtt
actttgtattttgatgaaataatcgttaaataa

DBGET integrated database retrieval system