KEGG   Simiduia agarivorans: M5M_05065Help
Entry
M5M_05065         CDS       T02281                                 

Definition
alpha amylase catalytic subunit
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
saga  Simiduia agarivorans
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:saga00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1126250..1127998
Genome map
AA seq 582 aa AA seqDB search
MNAINLQLRQKLSDHLHIIYQQVQPELAIVDCVDELLDIMQIAADAPSPDAYANHWSERD
ALMITYGDSLLAPQEKPLETLKNFIDEQLAGVINSIHILPFFPYSSDDGFSVIDYSTVNE
SLGDWQHIRALGEQYRLMADLVINHCSARSYWFENFIKQQSPGKDYFFTASPQADLSAVV
RPRTNPLLQAVETQAGTRHVWCTFSFDQVDLDFRNPEVLKQFVRIVRLYLDQGVRIFRLD
AIAFLWKVPGTSSINLPETHEVVRLLRTLIEHAEPGAVIITETNIPNQENLSYFGNNNEA
HWIYNFSLPPLLVQALLTGNGTHLKRWMMTMPPARNGTTYFNFIASHDGIGLRPTEGLLN
DDELNALTHALEQFGGRISWRTSADGSPRPYEANIALYDALKGTIAGPDNFNFERFICAH
AIMLGLEGVPAFYIHSLLATGNDYQRMEHSGHNRAINRHQWQKAQLDSQLADPNSQHARV
FNALKRLIGIRAEQPAFHPNATQFTLHLGDSIFAFWRQSMDRQQNIFCLSNLAHTAQDVP
LSAINLVCTDNWRELISGETLDPQAELLHLAPYQTVWISNGC
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgataaacctgcaactacggcaaaaattgtcggaccatttgcacatcatctac
caacaggtacaacctgagcttgcaattgttgattgcgtggatgaactgctggatattatg
caaattgcggccgacgccccctcgcccgatgcctacgccaatcattggagcgagcgggac
gcgttgatgatcacctacggcgacagcttgctggcgccacaggaaaaaccgctggagacg
ctgaagaactttatcgatgagcagctggccggtgtcatcaacagcatccatattctgcct
tttttcccctacagctcagacgacggtttttccgttatcgactattccaccgtcaacgaa
tcactgggcgattggcagcacattcgcgccctgggtgagcagtaccgcctgatggcagac
ctggtcattaaccattgctcggcgcgcagttactggtttgaaaacttcatcaaacaacaa
tcgccggggaaagactatttttttaccgccagcccacaagccgatttatccgccgtggtc
agaccccgcaccaacccgctgctgcaggcggtagagactcaggccggcacccgccatgtg
tggtgcaccttttcttttgatcaggtggacctggacttccgcaacccggaagtactcaag
caatttgtccgcattgtgcgtttgtatctggatcagggcgtgcggattttccggctcgat
gccattgcatttctgtggaaagtgcccggtaccagttcgatcaacttaccggaaacccac
gaggtagtgcgcctgttgcgtactttgattgaacacgctgaacccggtgccgtgatcatc
accgaaaccaacattcccaaccaggaaaatctgagctattttggcaacaacaacgaagcc
cactggatctacaacttctcgttgccacctctgctggtgcaggcattactgaccggcaac
ggcacgcatctgaagcgctggatgatgaccatgccgccggcgcgcaacggcaccacctat
ttcaatttcattgccagtcacgacggcatcggcctgcgtcccaccgagggcctgctgaac
gatgatgagctcaatgcgctgacccatgcgctcgaacaatttggtggccgcatttcctgg
cgcaccagcgccgacggcagcccacgcccctacgaggccaatattgccttgtacgatgca
ctcaaaggcaccattgccggccctgacaattttaattttgagcggtttatttgcgcccac
gccatcatgctgggcctggaaggtgtgccggcgttttatattcacagcctgctggccacc
ggcaatgactaccagcgcatggagcattcgggccacaaccgggccatcaaccggcaccag
tggcagaaggcgcaactggacagccaattggcagaccccaacagccagcacgcgagggtt
ttcaacgctctcaagcgactgatcggcatcagggctgaacagccggcctttcatcccaac
gccacccagttcacgctgcacctgggcgacagtatctttgccttctggcgccaatccatg
gaccggcaacagaatatcttttgcctatccaatctggcgcacactgcgcaggatgtgccc
ttgtcagccattaacctggtgtgtaccgacaattggcgggaattgatcagtggggagacc
ctcgacccgcaggccgaactactgcacctggccccttaccagacagtgtggatcagcaat
ggctgttag

DBGET integrated database retrieval system