KEGG   Simiduia agarivorans: M5M_05835Help
Entry
M5M_05835         CDS       T02281                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
saga  Simiduia agarivorans
Pathway
saga00010  Glycolysis / Gluconeogenesis
saga00020  Citrate cycle (TCA cycle)
saga00620  Pyruvate metabolism
saga01100  Metabolic pathways
saga01110  Biosynthesis of secondary metabolites
saga01120  Microbial metabolism in diverse environments
saga01130  Biosynthesis of antibiotics
saga01200  Carbon metabolism
Module
saga_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M5M_05835
   00020 Citrate cycle (TCA cycle)
    M5M_05835
   00620 Pyruvate metabolism
    M5M_05835
Enzymes [BR:saga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     M5M_05835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N NQRA DUF2118 Peptidase_M23 HlyD_3 IBP39
Motif
Other DBs
NCBI-ProteinID: AFU98368
UniProt: K4KK15
Position
complement(1285077..1286699)
Genome map
AA seq 540 aa AA seqDB search
MAIETIAVPDIGGAEDVDVIEICVSVGDEVSEGDSLIVLETDKASMEVPSPVSGKVVSIA
LKEGAKVSQGAVIGVVAVAGNGASAPKAEAAPAPAQAAAPVAAAPVAAAAPAGDRDLVIP
DLGGSENVDVIEVCVAVGDTVAEGDSLVVLETDKASMEVPAEFAGTIKSLTVKEGDKLSA
GSVIGVIVAEGKAAPVASAPAAAPAAAPAPATTAAPAAPATAAATSAADEAVPGFVDSVY
AGPAVRKLARQLGVDMTKIKGSGPRNRLTKDDIRSYVKTIIQDVQTGKLQSGSVGSGIPA
VPAVDFAKFGPIEMVKMSKIKKVTAANMQRSWLNVPHVTQWDDADITELEAFRNSMKAEA
EKRGVKLTPVPFLLKACAAALRAEPSFNVSMHHDGEHIVQKDYVHIGMAVDTPNGLMVPV
IRDVDKKGLYELAEEATALAKKARDGKLMPNDMQGGCFTISSLGAMGGNGFTPIVNTPEV
AILGVSRAQVKPVWNGKEFEPRNMLPLSLSYDHRAINGGDAGRFFTYLTAVIGDIRKLLL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
ttggctattgaaacaatcgcggtgcccgacattggcggcgccgaagacgtggatgtaatc
gaaatctgcgtgagtgttggcgacgaagtgagcgaaggcgattcactcatcgtgttggaa
accgacaaagcgagcatggaagtgccgtcacctgtctccggcaaggtagtgagcattgcg
ttgaaagaaggcgccaaggtatcgcagggtgccgtgattggtgtagtggctgtggccggt
aacggtgcgtctgcgcccaaagccgaagccgcaccggcgcctgctcaggcagctgcgcct
gtggcggcagcacccgttgccgctgcagcgcccgccggtgaccgggacctggtgattccg
gatctgggtggcagcgaaaacgtggacgtgattgaagtgtgtgtggctgtaggcgacaca
gtagctgaaggcgattcactggtggtgctggaaaccgataaggcctccatggaagtgccc
gcagaatttgccggcaccatcaaaagcctgaccgtgaaagaaggcgacaaactctctgcc
ggttcggtcattggtgtgattgtggcggaaggtaaagccgcgcccgttgcttcagcgcca
gcggctgctccagccgctgcacctgcgccagccactacggcagcacccgctgcgccagca
acggcagcagcaacatctgcagccgacgaagccgtccccggttttgtggattccgtatac
gccggccccgctgtgcgcaaattggcgcgccagcttggcgtggacatgaccaaaatcaaa
ggcagcggcccgcgcaatcgcctgaccaaagatgatattcgctcttacgtgaaaaccatc
atccaggacgtgcaaaccggcaagctgcaatccggcagcgtgggctccggtattccggct
gtgccggcggtagattttgccaagtttggcccgattgaaatggtcaaaatgagcaaaatc
aaaaaggtcaccgccgccaatatgcagcgcagctggctcaacgtgccgcacgtgacccaa
tgggacgacgccgacatcaccgagctcgaagccttccgcaacagcatgaaagcagaggca
gaaaagcgcggcgtaaaactcacacccgtgccgttcctgctcaaagcctgcgccgcagca
ttgcgtgcggagccaagctttaatgtgtccatgcaccacgacggcgagcacatcgtacaa
aaagattacgtccacatcggcatggcggttgatacccccaacggcctcatggtgcccgtg
atccgcgacgtagacaaaaaaggcctgtacgaactggcagaagaagccaccgccctcgcg
aagaaagcgcgcgatggcaagctgatgccgaacgacatgcagggcggttgttttaccatt
tcttcactgggtgccatgggtggcaatgggtttacccccatcgtcaacacacctgaggtt
gccatcctgggcgtatcgcgcgcacaggtgaagccggtgtggaatggtaaagagtttgaa
ccgcgcaacatgttgccgctgagcttgtcctatgaccaccgggcgattaatggtggggat
gcaggtaggttctttacctatcttacggcggtgatcggggatattcggaaattgctgttg
tga

DBGET integrated database retrieval system