KEGG   Simiduia agarivorans: M5M_07165Help
Entry
M5M_07165         CDS       T02281                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
saga  Simiduia agarivorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M5M_07165
   01230 Biosynthesis of amino acids
    M5M_07165
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M5M_07165
   00030 Pentose phosphate pathway
    M5M_07165
   00051 Fructose and mannose metabolism
    M5M_07165
   00052 Galactose metabolism
    M5M_07165
  Energy metabolism
   00680 Methane metabolism
    M5M_07165
Enzymes [BR:saga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     M5M_07165
Protein phosphatases and associated proteins [BR:saga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     M5M_07165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1609387..1610643
Genome map
AA seq 418 aa AA seqDB search
MTRKNAFYAQSGGVTAVINASACGVIETARAHSDKIGTVYAGNNGIIGALREELIDTSAE
SADTIAALRHTPSGAFGSCRYKLKSLEQNRAEYERLIDVFKAHDIGYFFYNGGGDSADTC
LKISQLSETMGYPIQAIHIPKTVDNDLPFTDNCPGFGSVAKYVAVSIREAGLDVASMCES
STKVFIMEVMGRHAGWIAAAGGLAAEVDGDAPQIILFPEIAFDKAKFLARVDECVKRYGY
CAIVASEGAQYADGSFLADSGNVDAFGHKQLGGVAPTLASMVKQELGYKYHWALADYLQR
AARHIASGTDVEQAYAVGKAAVEKAIEGKSGIMPTIERAASAEYRWSIGEAPLDQVANVE
RKMPRDYISEDGFHITDKARDYLLPLIQGEDYPPYRDGMPVYAKLKKVMTPKKLADWQ
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgacaaggaaaaacgcgttttacgcgcaatccggtggggtaactgcggtgatcaatgcc
agcgcctgcggcgtgattgagactgcccgggcccacagcgacaagatcggcacagtgtac
gccggcaataacggcatcatcggtgcgctgcgcgaagagctgatcgataccagcgccgag
tcagccgacaccattgccgccctgcgccatacgccttcaggcgccttcggctcctgtcgc
tacaaactgaaaagcctggaacaaaaccgggccgagtacgagcgcctcattgatgtgttc
aaagcgcacgacatcggttattttttttacaacggcggtggtgactcggccgacacctgc
ctgaaaatcagccagctgtctgaaaccatgggttatcccattcaggcgatccatattccc
aaaaccgtggataacgacctgccgtttaccgacaactgcccgggattcggctctgtggcg
aaatacgtggctgtgtccatccgcgaagcgggcctggacgttgcttccatgtgcgaatcc
tccaccaaggtgttcatcatggaggtcatgggccgccacgcgggctggattgcggctgcc
ggcggactcgctgccgaagtggacggcgatgcgcctcagattatcctgttcccggaaatc
gccttcgataaggccaaattcctcgcgcgcgtggacgaatgcgttaagcgctacggttac
tgcgccatcgtcgcctctgaaggtgcccagtatgcagacggcagcttcctggccgactcc
ggtaacgtcgacgcctttggccacaaacaactgggtggcgtagcgccaacactggccagc
atggtcaagcaggaactgggctacaaataccactgggcactggccgattatctgcaacgc
gccgcgcgtcacattgcctccggcaccgacgttgaacaagcctatgcagtgggcaaagcc
gccgtggaaaaagccatcgaaggcaaaagtggcatcatgcccaccatcgagcgcgcagcc
tctgctgaataccgctggtccattggcgaagcaccgctggatcaggtagcgaatgtggag
cgcaagatgccgcgcgactacatcagtgaagacggcttccacatcaccgacaaagcccgt
gactatctgctgccgttaatccagggcgaagactacccgccctaccgcgacggcatgccg
gtatatgccaagctgaaaaaagtcatgacgcccaaaaaactggccgactggcagtaa

DBGET integrated database retrieval system