KEGG   Simiduia agarivorans: M5M_07515Help
Entry
M5M_07515         CDS       T02281                                 

Definition
di-heme cytochrome c peroxidase family protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
saga  Simiduia agarivorans
Brite
Enzymes [BR:saga01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     M5M_07515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1680102..1681316
Genome map
AA seq 404 aa AA seqDB search
MTKYFLLGLMCLSASAVATATTDASITLANHCPPGFELTQQNSCKLHSLYDQYNSLYNRG
VGGLKTALPTRRDGFSPQQIDLGRHLFFDPILSGDKSLSCASCHHPQLGFADGLPRSIGI
HGREATRAAPSLWNMAFLTRFFWDARASSLEEQMQGPLYSDVEMGNNPGQLLTDLNANAD
YRRLFAEAFPEQAQTITLDQIYLAIAAFETSLVSLNSRYDHYAHGFHGALNQTEQEGLNI
FRSFVARCAECHTPPLFTNQQVAVIGVAEPDGRPFDTGAETIFNNPTWRGGFKVPSLRNI
ARTAPYMHSGTFDSLRDATEFYTLGRGHALTEAQNKNMVLHWHIWEPKLTDDELDLLVTF
METLTDESFTPAIPAQVPSGLPPVGQLPPALQQTITFEEGNSDE
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagtattttttactcggcctgatgtgcctgagtgccagcgccgtggcgacggca
accaccgacgcatcgatcacgctggcgaatcactgcccgccaggctttgagctcacgcag
caaaacagctgcaaactgcacagcctgtacgatcaatacaactcgctctataaccgcggt
gtgggcggcctgaaaactgccctgcccacgcgccgcgacggcttcagcccccaacagata
gacctgggccgacacctgtttttcgacccgattctgtccggcgacaaaagcctctcttgt
gccagctgccatcacccccaattgggcttcgccgatggcctgccccgctccatcggcatt
cacgggcgcgaggccactcgcgccgcaccgagcttatggaacatggcgtttctgacccgt
tttttctgggatgcgcgcgcgtccagcctggaagaacaaatgcagggcccgctctattcg
gacgtcgaaatggggaataatccgggccaattgctcaccgacctgaatgccaatgcagat
taccggcgcttgtttgccgaggcctttcccgagcaagcgcaaacgatcacgctggatcag
atctatctcgcgatcgccgcctttgagacctcgctggtgtcgctcaacagccgctacgat
cactacgcccacggcttccacggcgcgctcaatcagaccgagcaggaaggcctgaatatt
ttcaggagttttgtggcccgttgtgccgagtgtcacacgccgcccttgtttaccaaccaa
caagtggcagtgattggcgtcgccgagcccgacggccggccgttcgacaccggcgcggaa
acgattttcaacaaccccacctggcgtggcgggtttaaggtacccagtctccggaatatt
gcccgcaccgcgccctatatgcactcgggcactttcgattctctgcgcgatgccaccgag
ttttacacgctcgggcgcggccatgcactgaccgaagcgcaaaataaaaacatggtgctg
cactggcatatctgggagcccaagctcaccgatgatgaactggatttactggtgacgttt
atggaaacgctcaccgacgaaagctttaccccggccatacccgcgcaggtaccatccggc
ctgccaccggtgggccagttaccacccgcattacaacaaacaataacgttcgaagaggga
aacagcgatgaataa

DBGET integrated database retrieval system