KEGG   Simiduia agarivorans: M5M_08495Help
Entry
M5M_08495         CDS       T02281                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
saga  Simiduia agarivorans
Pathway
saga00071  Fatty acid degradation
saga00280  Valine, leucine and isoleucine degradation
saga00281  Geraniol degradation
saga00310  Lysine degradation
saga00362  Benzoate degradation
saga00380  Tryptophan metabolism
saga00410  beta-Alanine metabolism
saga00640  Propanoate metabolism
saga00650  Butanoate metabolism
saga00903  Limonene and pinene degradation
saga00930  Caprolactam degradation
saga01040  Biosynthesis of unsaturated fatty acids
saga01100  Metabolic pathways
saga01110  Biosynthesis of secondary metabolites
saga01120  Microbial metabolism in diverse environments
saga01130  Biosynthesis of antibiotics
saga01200  Carbon metabolism
saga01212  Fatty acid metabolism
Module
saga_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    M5M_08495
   00650 Butanoate metabolism
    M5M_08495
  Lipid metabolism
   00071 Fatty acid degradation
    M5M_08495
   01040 Biosynthesis of unsaturated fatty acids
    M5M_08495
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M5M_08495
   00310 Lysine degradation
    M5M_08495
   00380 Tryptophan metabolism
    M5M_08495
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    M5M_08495
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    M5M_08495
   00281 Geraniol degradation
    M5M_08495
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M5M_08495
   00930 Caprolactam degradation
    M5M_08495
Enzymes [BR:saga01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     M5M_08495
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     M5M_08495
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     M5M_08495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 AlaDh_PNT_C 2-Hacid_dh_C NAD_binding_2 UDPG_MGDP_dh_N F420_oxidored
Motif
Other DBs
NCBI-ProteinID: AFU98888
UniProt: K4KLF0
Position
complement(1883467..1885461)
Genome map
AA seq 664 aa AA seqDB search
MVITSAKKVFFAGGDLNELLAAKPGDEAAFFAMVEKIKSQLRALERLPVPVVAAINGAAL
GGGFEICLACNYRVAVDSPAVSLGLPEVSLGLLPGGGGIVRMVNLLGLEAALPYLLEGKK
ADAGRALAAGLIHATVADQSQLVPAAKAWIASQVDNPDAALQPWDHKGHKIPGGSAGSPK
LAQLLAIAPAMLAQKTRGLLPAPEKILDCAVEAARLDFDTALRKEGRAFTELVMTPEAKN
MITTFFFQLNKINAGASRPDNIAPHTVKKLGVLGAGMMGQGIAYVAAKVGIDVVLKDISM
AAAEKGKAYSAKLVEKQVARGRLDLAGAEALLARIQPTERDQDLAGCDLIIEAVFEQIDL
KNKITLGTEQYLSDDGFWGSNTSSLPITQLAEASAHPEKFIGIHFFSPVDKMPLVEIICG
KKTSDETLARAFDFVRQIKKTPIVVNDSLAFFTSRTFSTYLDEAARMVVEGIHPVVVDNL
GKAVGMPVGPLTVHDEVSLELTRKIHQTWADMGVENQWGEHDAMAEIIKTLVVEHGRGGK
HYNGGYFDYGDQGKTIWPGLLDKYFDGGNATPEQDIKDRLLFRQVIETLKCLESGVLRSV
ADANIGSIMGIGAPVHTGGFVQFINTYGLERFRARCAELADAYGERFKCPAIVSEKIERA
ETFN
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatcaccagcgccaaaaaagtgttttttgccggcggcgatctgaatgaattattg
gccgccaagcccggtgacgaagccgcattctttgccatggtggaaaaaatcaaaagccag
ctgcgtgcgctggagcgattgccggtgccggtggtggcggccatcaatggagcggcgctc
ggcggcggatttgaaatctgcctggcctgtaattatcgcgttgcggtggattcgcccgcg
gtatcgctgggtttgcccgaagtgtctctgggcttgttgcccggtggcggtggcattgtc
cgtatggtcaatttgctggggcttgaagcggccttgccgtatttactggaaggtaaaaaa
gcagatgccggacgcgcattggcggcgggtctgatacacgccaccgtggcggatcaatcc
caactggtgccagcggccaaagcctggatagcatcacaagtcgacaacccagatgctgcg
ttgcaaccctgggaccacaaaggccacaaaatacccggtggttcagccggctcacccaag
ctggctcaattgttagctattgctccggcgatgttggcgcagaaaacccgtgggcttttg
ccggcgccggaaaaaattctcgattgtgcggtggaagcggcaaggctggattttgatacg
gctttgcgcaaagaagggcgggcctttaccgaactggtcatgacgcccgaagcgaaaaac
atgatcaccacgtttttcttccagctcaataaaatcaacgccggtgccagccggccggac
aatatcgcaccacacacggtgaagaaactgggtgtgctcggtgccggcatgatgggccag
ggcatcgcctatgtggccgccaaggtgggcattgacgtggtgctgaaagatatttccatg
gcggcggcagaaaaaggcaaagcctattccgccaagctggttgaaaaacaagtggcccgc
ggccggctggatctggccggtgccgaggccctgcttgcccgcattcagccaacagagcgc
gaccaggacctggccggctgcgatctgattattgaagccgtgtttgagcagattgatctc
aaaaacaaaatcaccttgggtaccgagcagtatctgtcagatgatggattctggggctcc
aatacctccagtctgcccattacccagttagccgaagccagcgcccacccggaaaaattt
atcggtatccacttcttttctccggtggacaagatgcctttggttgagattatctgcggc
aaaaaaaccagcgatgaaaccctcgcgcgggcgtttgattttgtccggcaaattaaaaaa
acgcccattgtggtcaacgactccctggcgtttttcacctcccgcaccttctccacttat
ctggacgaagcggcccggatggtggttgagggcattcatcccgtggtggtagacaacctg
ggcaaggcggtgggtatgccggtggggccattgactgtgcacgatgaagtcagtctggaa
ctgacccgcaaaattcaccagacctgggccgacatgggggtggaaaaccagtggggcgag
cacgacgccatggccgaaattatcaagaccttggtggtggaacatggccggggtggcaaa
cactataacggcggctattttgattacggcgatcagggcaaaaccatttggcctggcttg
ctggataagtattttgatggcgggaatgcaacgccggaacaggacatcaaagaccggttg
ttattccgtcaggtgattgaaacactcaaatgcctggagtcgggcgttctgcgctcggtg
gcggatgccaatatcggttcgattatgggtattggtgcgccggtgcatacgggcggcttt
gtgcaattcattaacacctatggtcttgaacgtttccgcgcacgttgcgccgagttggcc
gatgcctacggtgagcgttttaagtgtccagccattgtctcggaaaaaatcgagcgggct
gaaacgtttaactga

DBGET integrated database retrieval system