KEGG   Simiduia agarivorans: M5M_08720Help
Entry
M5M_08720         CDS       T02281                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
saga  Simiduia agarivorans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:saga01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:saga00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1935668..1936849)
Genome map
AA seq 393 aa AA seqDB search
MSTHNSQDDGNSESQNLKTRAQMARSQRWVVKIGSSLLTNNGQGLDKPAIAEWVAQIARL
RQAGIEVVLVSSGAVAAGMRRLGWTVRPHAMHELQAAAAVGQMRLVQNYEQEFQKHDLHT
AQVLLTHDDLSNRERYLNARSTLTTLLDFGVVPVVNENDTVVTDEIRFGDNDTLGALVAN
LVEADVLVLMTDQNGMYSADPRNNPDARLLSYLPAFDSRLDDMAGDGGALGRGGMVTKVR
AARLAARSGTHTLIVGGRLPSVLDSVRAAESVGTLLYADCEPKTARKNWLAGHLQTLGEL
VLDDGAVRALQHKGKSLLPVGVCAVSGQFTRGDMVVCRDLNGAEIARGLVNYGADEVSQL
IGTGSDQIEAVLGYVDEQELIHRDNLVLVDWKD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagtacacacaatagccaggatgatggcaatagcgagtcacagaatctgaaaacccgc
gcgcaaatggcgcgcagccagcgctgggtggtaaaaattggcagctccttgctgaccaat
aatggccagggcttggacaagccggcgattgccgagtgggtggcgcaaattgcacgcttg
cggcaggccggtatcgaggtggtgctggtatcatccggtgccgttgcagccggtatgcgg
cggctgggctggaccgtgcgcccgcacgccatgcacgagcttcaggccgctgcggcagtg
ggccaaatgcgtctggtgcagaattacgagcaggaattccagaagcacgatctgcacacc
gcgcaggtgttgctgacccacgacgacctgtccaatcgtgagcgctatctcaatgcgcgc
tcaaccctgaccacattgctcgattttggggtggtgccagtggtgaacgaaaacgacaca
gtggtgaccgatgaaatccgatttggcgataacgacacgctaggggccttggtggcgaac
ctggtggaggcggatgtgttggtcttgatgaccgaccagaacggcatgtattcggccgac
ccccgcaataaccccgatgcccgcttgctcagctatttgccggcgtttgattcgcgtctg
gacgacatggccggcgatggcggagccctggggcgaggtggcatggtgactaaagtgcgg
gcggcccgactggcggcgagaagtggcacccacacgctgatagtgggtggtcgcttacct
tcagtgctcgacagtgtcagggctgccgagtccgtgggcaccctgttgtatgcggattgt
gagccgaagacggcacgtaagaactggctggcggggcatttgcagacgctgggcgaattg
gtgctggatgacggtgccgtgcgggcgttgcagcacaaaggcaaaagcctgttgcctgtg
ggcgtttgcgcggtcagcggccagtttacccgcggggatatggtggtttgccgggatctg
aatggcgccgaaatcgcgcgcggcctggtgaattacggtgccgatgaggtcagtcagctg
attggtaccggtagcgatcagatcgaagcggtattgggctatgtggatgagcaggagctg
atccatcgcgacaatctggtgttggtggactggaaagactga

DBGET integrated database retrieval system