KEGG   Simiduia agarivorans: M5M_09340Help
Entry
M5M_09340         CDS       T02281                                 

Gene name
ipk
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
saga  Simiduia agarivorans
Pathway
saga00900  Terpenoid backbone biosynthesis
saga01100  Metabolic pathways
saga01110  Biosynthesis of secondary metabolites
saga01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M5M_09340 (ipk)
Enzymes [BR:saga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     M5M_09340 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C Amidohydro_1
Motif
Other DBs
NCBI-ProteinID: AFU99053
UniProt: K4KLU7
Position
complement(2058438..2059304)
Genome map
AA seq 288 aa AA seqDB search
MIERSGLRWPAPVKLNLCLHITGRRADGYHNLQTLFQLLRYGDFLSFRPLEDARVFLRNP
LPGVDDEQNLVVRAARLLQSATGCQKGAIIDLDKRVPMGGGIGGGSSDAATTLVALNHYW
QTGLSLSHLAELGLQLGADVPVFIEGKTAWAEGVGERLQPVQMPEIWYLVVTPNCHVSTA
EIFSHKDLTRDSADITVAAFLEQGGRNDCQDLVARLHPEVRQVIDWLNQFGAAQMTGTGA
SVYCAFASAEAAQSVLCVMPKQWQGFVAQAVNTSPLHDLLQQIDDTGA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgattgagcgatccggtctgcgctggccggcaccggtcaagcttaacttgtgcttacac
attaccggccggcgggcagatggctaccacaacctccaaaccctgttccaactgctccgt
tacggcgattttctgagcttcagaccgctggaagatgccagggtattcctgcgcaatccc
ttgccaggggtcgacgacgagcaaaacctggtggtgcgggcggccagattgctgcagtcc
gccaccggttgccagaaaggtgcaataatcgatttggataagcgggtgcccatgggcggt
ggcattggtggcggctcatccgatgcggcaaccaccttggttgccttgaatcactactgg
caaaccgggctcagtctgtcgcatctggcggagttgggcttgcagctgggtgccgacgtg
ccggtctttatcgaaggcaaaacagcctgggccgagggggtgggtgagcgccttcagcca
gtgcaaatgcccgagatctggtacctggtggtcaccccaaattgccatgtttccaccgct
gaaatattttcccacaaagatttgacaagagactcggccgacattacagtagcggccttt
cttgagcagggtggtcggaacgactgtcaggatctggtagccagactccacccggaagtg
cgccaagtcattgattggcttaatcaatttggtgctgctcagatgactggaacaggtgcc
agtgtgtactgcgccttcgccagtgcagaggccgcacaatccgttttgtgcgtgatgccg
aagcagtggcaagggtttgtagcgcaagctgtaaacacatcgccgttacatgacctgtta
cagcaaattgacgatactggggcatag

DBGET integrated database retrieval system