KEGG   Simiduia agarivorans: M5M_09765Help
Entry
M5M_09765         CDS       T02281                                 

Definition
putative phosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
saga  Simiduia agarivorans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:saga00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2162657..2163175
Genome map
AA seq 172 aa AA seqDB search
MARVFLGLGSNTQKHKHLCAGLDALAQTFGPLDISPVYESLSVGFDGRNFYNLVVGIHTS
LDVAALSKALKAIEDANGRLRDGPKFAPRTLDIDILTYDDLVGVYAGVELPRDEVWLNAF
VLRPLSELAPDDILPGRSETYAALWQAYSNPSQKLWPVSFIWCGRELSPVAS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcacgggtatttttaggtttgggcagcaatacccagaagcacaagcacctttgtgcc
gggctggatgcgctcgcgcagacctttggcccactcgacatttctccggtgtatgaaagc
ctgtctgtgggctttgatggacgcaatttttacaacctggtggtgggtatccacacatca
ctggacgtggcggcactgtcaaaagccttaaaagccattgaagatgccaacggccgcctg
cgcgacggccccaagttcgccccccgcacgctcgatatcgatattctcacctacgacgat
ctggtgggggtttacgcaggtgttgaactgcccagggatgaagtgtggctcaatgcgttt
gtgctgcgtccactatccgaattggcgccggacgacatactgcccggtcggtccgaaacc
tacgcagccctgtggcaagcctacagcaacccgtcacaaaaactctggcccgtcagtttt
atctggtgcggacgcgagctcagccccgtcgcgtcctga

DBGET integrated database retrieval system