KEGG   Simiduia agarivorans: M5M_11595Help
Entry
M5M_11595         CDS       T02281                                 

Definition
(GenBank) hypothetical protein
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
saga  Simiduia agarivorans
Brite
Enzymes [BR:saga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     M5M_11595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2585522..2587300)
Genome map
AA seq 592 aa AA seqDB search
MTVKDANYWRDKYRELLLERDQGRKVDTGDYQQAIALLADALGGLEPELASAMAVVLKQA
KRNEWGKPGQLALLKESLNQFEKRLSLQREREQQAVKAAADALAIPHLANGKALATKIAK
LYKQQKHASDWAKLFEALAELQPAGPAPEQPGLMSRLFGGKKPDAEAESEVATREDATAA
ISEDPAPAGNDDTQTELLDADEPAPTNAAPDPDEAPAPESLSSVAHAQRQSLSGHWIAAQ
DVGLHEPPFSKISDRISTVLGDFLRQIEPPWPAVAEKASAARLRIDGGLNWYELVPTLED
IRDLVMALLVNAKSDYQTYLVGLLEKLNTLLQLTGEAVIDIEQDEAGFIASLEQNVGSFS
QALQSMNDVAELKTLVQTKVESLGDILARRKQQNAESGLLAKVQALQTQVAELQAEAAGR
QQELETEKAKARTDALTGLPNREHYNERVHHEVERFKRYQRPVSMAVCDIDHFKSFNDNY
SHQAGDRVLKVIGQAIAKKLRDTDFMARYGGEEFVVIMPETTGPDCKLKMDRIREAVAGT
AFKFKDQALQITFSCGIAEIIEGDSPSTLFARADKKLYDAKDAGRNCCQLAE
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtaaaagacgccaattactggcgcgacaaataccgcgaattactgttggagcgc
gatcagggccggaaagtggataccggcgattatcagcaggccatcgccttgctggccgac
gcgctgggtggcttggaacccgagctggccagtgccatggcggtggtgctgaagcaggcc
aagcgcaatgaatggggtaagcccggccagctggcgctgttgaaggaaagcctcaatcag
ttcgaaaagcgtctgtcgctccagcgcgagcgggaacaacaagctgttaaggcggcagcc
gacgcgctcgcaatcccccatctggccaatggtaaggcgctggcaactaaaatcgccaag
ctatacaagcagcaaaaacacgccagcgattgggccaagctgtttgaggcgctggcggag
ctacagccggcgggcccggccccggaacagccgggcctgatgagccgtttgtttggcggc
aaaaaaccggacgcggaagcggaatccgaagtcgctacccgcgaggatgcgaccgccgct
atcagcgaggacccagcacctgccggcaacgacgacacccaaactgaactgcttgacgcc
gatgaacctgcgccgacaaacgcggcgcctgacccggacgaagcgccggcacccgagtcg
ctttcatccgtggcgcacgcgcaacgtcagagtctgagtgggcactggattgcggcgcag
gatgtgggattacacgaaccgccgttcagtaaaatcagtgaccggatttccacggtgttg
ggcgattttctgcgccagatagagccgccatggcccgcggtggccgaaaaagccagtgct
gcgcgcctgcgtatcgatggcggcctcaactggtatgagttggtgcccaccctggaagac
atccgcgatctggtgatggcactgctggtcaatgccaaaagcgattaccagacctatctc
gtgggcctgttggaaaaactgaataccttgctgcaactcaccggcgaggcggtgattgat
atcgaacaggacgaggccggtttcattgccagtcttgaacagaatgtgggttccttctcg
caggcgttgcagtcaatgaatgacgtggctgaactgaaaacgctggtgcaaaccaaagtg
gaatcgctgggggatattcttgcccgccggaaacaacaaaatgccgaatcgggcttgctg
gcaaaagtgcaggcgctgcaaacccaggtggccgaattgcaggcagaagcggccgggcgc
caacaggaactggaaaccgaaaaagccaaagcacgcaccgatgcgcttaccggtttaccc
aatcgtgagcactacaacgagcgggtacaccatgaagtggagcgctttaagcgctatcag
cggccagtgtccatggcggtatgtgacatcgatcatttcaagtccttcaacgacaactac
agccatcaggcgggcgaccgggtgttgaaagtcattggccaggccattgccaaaaaattg
cgcgacacggatttcatggcccgctacggcggcgaggaatttgtcgtgatcatgccggaa
accaccggccccgattgcaaactgaaaatggaccgcatacgggaagcggtggccggcacg
gcgttcaagttcaaggatcaggcattgcagattacgttttcctgcggcatcgcagaaatc
attgagggcgattcaccttcaaccttgttcgcccgcgctgacaaaaaactttacgatgcc
aaagacgctggcaggaattgttgtcagctggcggaatga

DBGET integrated database retrieval system