KEGG   Simiduia agarivorans: M5M_12760Help
Entry
M5M_12760         CDS       T02281                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
saga  Simiduia agarivorans
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    M5M_12760
Enzymes [BR:saga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     M5M_12760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2801734..2802348)
Genome map
AA seq 204 aa AA seqDB search
MTRGNLYTVSAPSGAGKTSLVQALVDSTPGIRVSVSHTTRAMRPGEVEGVNYHFVSQDTF
MEMLGEAQFLEHARVFNNLYGTSKVWVEAQLAAGTDVILEIDWQGAQQVRKLFEDAIGLF
ILPPSRDALRARLTGRGQDSEDIIDGRMQEAINEMTHYVEADYLIINDDFDTALQEFRSL
VISQRLTQLHQSSRHAQLLQELLS
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcggaaacctttacaccgtctcggcaccttccggcgccggcaaaaccagcctg
gtgcaagccctggtggattccacacccggcatccgggtgtctgtgtcgcacaccacccgc
gccatgcgtcccggcgaagtggagggcgtgaattaccattttgtgtcccaggatacgttt
atggaaatgctgggcgaagcccagttcctggaacacgcgcgggtgttcaacaacctctac
ggtacgtccaaagtgtgggtggaagcgcaattggctgccggtaccgatgtgattctggaa
atcgactggcagggcgcccagcaggtgcgcaagttgttcgaagatgctatcggcctgttt
attctgccaccatcgcgcgatgccttgcgcgcgcgcctcaccggtcgtggtcaggacagc
gaggacatcatcgacggccgcatgcaggaagccatcaacgaaatgacgcactatgtggaa
gccgactacctgatcatcaacgatgatttcgacaccgccctgcaggaattccggtcattg
gtcatcagccagcgcctgacccagttgcaccagagcagtcgtcatgcacagctgctgcag
gagctattgagctga

DBGET integrated database retrieval system