KEGG   Simiduia agarivorans: M5M_12800Help
Entry
M5M_12800         CDS       T02281                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
saga  Simiduia agarivorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M5M_12800
   00030 Pentose phosphate pathway
    M5M_12800
   00051 Fructose and mannose metabolism
    M5M_12800
   00052 Galactose metabolism
    M5M_12800
   00500 Starch and sucrose metabolism
    M5M_12800
   00520 Amino sugar and nucleotide sugar metabolism
    M5M_12800
  Nucleotide metabolism
   00230 Purine metabolism
    M5M_12800
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    M5M_12800
Enzymes [BR:saga01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     M5M_12800
    5.4.2.8  phosphomannomutase
     M5M_12800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2808181..2810610)
Genome map
AA seq 809 aa AA seqDB search
MTKSKAPAPQAKTAKPGKTAPKQPPYFLLLSVASMLICGLLAWVGYQLFVASAEQSNLRT
LADVELKKRVGAVSQWIQATQADVAAFGARDALATAVAYQEMERVEEYRRAVAKTFTGSE
SVQFFPRGSVQLNPEGNPPINFIQMDLINQAEARESTLPEAVKMPSGWFIQIATGLPTDK
EKPALGTMLLTLNMQALRTLLAAQNNEHGSTSLIQRFGTIEQTFFTSGNGEVDLVVTEAI
PDSNWQVSFKPSYTLANRASVNPIPFLGGCVVLLAILIAISAWLSRFIIQHKEVQQRAKA
REKAMMATKGTREQKDLDVKVKEEDKSLLGMDKDGATQESPAAPQVAEVEEDDGLSTIFR
AYDIRGVVGQALTPAFAESLGRALGTEALEQGESTLFVGRDGRIHSEELSINLVNGILST
GCNVINLGLIPSPLLYYACLTNNASQSGVIVTASHNPGEYNGFKMVIGGKTLTNDAIKAL
YTRIKREQFRQGAGVEQHENIADDYVERIFSDVALAADVKLVIDAGNGATGDIAPRLFEE
LGCFVETLYCDIDGRFPNHNPDPSRPENLKALIAKVKSTNADLGVAFDGDGDRLTVVTPK
GQIIWPDRLLMLFARDIVSRNPGADVLFDVKSTRQLNSLITSYGGRPIMWKTGHSNMKQK
MAETGALLGGELSGHIFIKDRWYGFDDGMYATARLLEIMTLRDQDIDSIFEAFPSQPSTP
EILVPIDEHRKFDVINKLVAQGNFQGGKLTTIDGLRVDFAKGWGLARASNTQPALTLRFE
GDNEETLAQLQALFKRELKKVDPNLELGF
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaaagcaaagcaccagccccgcaggcgaaaaccgccaaacccggaaagaccgcg
cccaagcagcctccctacttcctgctgctgtcagtggcctcgatgctgatttgcggtctg
cttgcctgggtcggctaccagttgtttgtggccagtgccgaacaaagcaatctgaggacc
ctggccgatgtggagttaaaaaaacgtgtgggtgccgtcagtcagtggattcaggccacc
caggccgatgtggcagctttcggggccagggatgcactcgccacagccgtggcttaccag
gagatggaacgcgttgaagaataccgtcgcgctgtcgccaaaacgtttaccggcagcgag
tctgtgcagttttttccacgcggctcggtccagctcaacccggaaggcaatccgcccatc
aactttattcagatggacctgatcaatcaggcggaagcacgcgagagcaccttaccggaa
gcggtcaaaatgccttctggttggttcatccagatagccaccggtctgcccaccgataag
gaaaaacctgcgctcggcaccatgttgctgaccttgaatatgcaggcactgcgcacgctg
ttagcggcgcagaataatgagcatggcagcaccagcctgatacagcggtttggcactatc
gagcaaacgtttttcaccagcggcaacggtgaggtggacctggtggtcaccgaggcaatc
ccggacagcaactggcaggtcagcttcaaaccgtcctataccctggcaaaccgcgccagc
gtgaaccccattccgtttctgggtggctgcgttgtcctgctggctattctcatcgccatc
agtgcgtggttgtcgcgcttcatcatccagcacaaagaggtgcagcaacgtgccaaggcg
cgcgaaaaagccatgatggccaccaaaggcacccgcgaacaaaaagacctggatgtgaag
gttaaggaagaagacaagtcgctcctgggaatggacaaagacggcgcaacgcaggaatcg
cccgccgcgccacaggttgctgaagttgaagaagacgatgggctcagcaccattttccgg
gcatatgatatccgcggcgtggtgggtcaggcgttgacacccgcattcgccgaatcgctc
ggtcgtgctttgggcaccgaagcattggagcagggcgaatcgactctgtttgtggggcgc
gacgggcgcattcacagtgaagagctatcgatcaatctggtcaacggcattctcagtacc
ggttgtaacgtcatcaaccttggccttattccttcacccctgttgtattacgcctgcctc
accaacaatgccagccagagcggcgtgatagtgacggccagccacaacccgggcgagtac
aatggcttcaaaatggtgatcggcggcaagaccctcaccaacgacgcgatcaaagcgttg
tacacccggattaagcgcgaacaattccgtcagggcgcaggcgtcgagcagcatgaaaac
atcgcggatgattacgtcgaacgaattttctcagacgtcgccttagcggctgacgtgaaa
ctggtgattgatgccggcaatggcgccaccggcgatatcgcaccccggctatttgaagaa
ctgggttgttttgtcgaaactttgtattgcgacatcgatggccgcttccccaaccacaat
cccgacccgagccggcccgaaaacctgaaagcgttaatcgccaaggtcaaaagcaccaat
gccgatctgggcgtcgcgttcgacggcgacggcgaccggctcactgtggtcacacccaag
ggccagatcatctggccggatcgtctgctgatgctgttcgcgcgcgatatcgtgtcgcgc
aatccgggtgccgatgtgctgtttgatgtaaaaagtacccgccaactcaacagcctcatt
acgtcctacggtggccgtcccatcatgtggaaaaccggccactccaacatgaaacagaaa
atggcagaaaccggcgcattgctgggcggcgagttgtctggccatatattcatcaaagat
cgctggtacggctttgatgacggcatgtacgccaccgcccgcctgctcgaaatcatgacc
ctgcgcgatcaggacatcgacagtatatttgaagccttcccgagccaaccgagtacgcca
gaaatcctggtacccatcgacgaacaccgcaagtttgatgtgatcaacaagcttgtcgct
cagggcaacttccagggcggcaagctcaccaccattgatggtttgcgcgtggacttcgcc
aaaggctggggtctggcgcgcgcatccaatacccaacccgccctgaccctgcgttttgag
ggtgacaacgaagaaacgctcgcgcaactgcaggccctgttcaagcgcgagctgaaaaaa
gttgatcccaatctggaattgggtttctga

DBGET integrated database retrieval system