KEGG   Simiduia agarivorans: M5M_13060Help
Entry
M5M_13060         CDS       T02281                                 

Definition
glycoside hydrolase family 9 domain-containing protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
saga  Simiduia agarivorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    M5M_13060
Enzymes [BR:saga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     M5M_13060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2851355..2853016
Genome map
AA seq 553 aa AA seqDB search
MKFSAYSVFVFTALLMACRPVPQSTHSHLYHNQLGYRIAGSKGVLVETPIPRNWQLVDAS
GNGVAEGEIKPVFWPEAGTQVAWLDFSTAQQAGHYSLSVEGLAPVPIVIQENPWLAVHDA
AMKSFYLNRAGQALERRYAGDYAREAGHRDTEVLVHSSAASDSRPEGTKISAPGGWYDAG
DYNKYVVNAGISTYTLLLAHQQYTQFYSQRQWAIPESGGALPDMLAEIKYNLDWMLAMQD
EDGGVYHKLTSLRFNPMEMPAQDDDARYVVHKNTAATLNFAAVMAMASREFKPFDPTLSE
HYLNAARNAWQWSVQHPALPYQQPEDVVTGEYGDQQLADEWFWAGAELAISTGDNSYIQP
LPESAAAIPAWSDVATLGLISLANHKPNSEWFNRLDAIAATLSARENTAPGFTLSAQEKD
FVWGSNAVAMNQAMVLIIASNLSGNQKYRDLAEKMLHYVLGANPTGYSFVSGFGSKQAKH
LHHRASEADGIEVPVPGMLIGGPNPDQQDNCPGYPSNLPALSYLDHVCSYSTNETAINWT
APLVFALATFSQD
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgaaattctccgcctacagcgtgtttgtgttcactgccttgcttatggcctgtcgcccc
gtgccgcaatccacacacagccatctctatcacaaccagttgggttaccggattgcgggc
agcaagggtgtattggttgagacaccgatcccgcgcaactggcagttagttgatgccagt
ggcaatggcgttgcagagggcgagattaagccggtgttttggccggaagcgggtacacag
gtggcctggctggatttttcaacggcgcagcaagcgggtcactactcgctctcggtcgag
ggtctggcaccagtgccgattgttattcaggaaaatccctggctcgctgtgcacgatgca
gcaatgaaaagtttctatctcaacagggctggccaggcattggagcgccgttacgcgggc
gactatgcacgcgaagccgggcatcgggacacggaggtgcttgtgcattcaagcgctgcc
tcagactcaaggccagagggcacaaaaatcagcgcgccgggcggatggtacgatgccggc
gactacaacaaatatgtggtcaatgccggtatcagcacctacacactgctgctggcgcat
cagcaatacacgcagttttattcacaacgccaatgggctattcccgagtcgggtggcgcc
ctgcccgatatgctcgcggaaataaaatacaacctcgattggatgctggctatgcaggat
gaggatggtggcgtttaccataaactcacctcgctgcgcttcaacccgatggaaatgcca
gcacaggatgatgatgcgcgttacgtggtgcataaaaatactgccgccactttgaatttt
gcagcggtgatggcaatggcgagtcgggaattcaagcccttcgacccaacacttagcgaa
cactacctaaatgcagcccgcaacgcatggcagtggtctgtacaacaccccgcccttccc
taccaacaaccggaggatgtagtcactggcgagtatggcgaccaacagttggccgatgaa
tggttctgggctggtgcggagcttgcgatcagtacgggcgacaacagctatatacaacca
ctgccagaatccgccgcagccataccggcctggtctgatgtggcaacactgggcctgatc
agcctggcgaatcacaaacctaacagcgagtggtttaacaggctggatgcaattgccgca
acactctctgcccgcgaaaataccgcgccgggttttacactgtctgcgcaggaaaaagat
tttgtctggggctctaacgccgttgcgatgaaccaggccatggtactgatcattgccagt
aacctttccggcaaccaaaaataccgcgatctggccgaaaaaatgttgcactacgtgctg
ggcgccaaccctaccggttacagttttgtttcgggctttggctcaaaacaggcaaagcac
ctgcatcatcgcgccagtgaagccgatggtattgaagtgcctgttcccggcatgctgatt
ggtggccccaatccggatcaacaagacaactgcccgggctatcccagtaatttaccggcc
ctgagttatctggatcatgtgtgctcatacagcacaaacgagacagccatcaactggacc
gctcctttggtattcgcgcttgccacattcagccaggattag

  All links  
No link information was found.   
DBGET integrated database retrieval system