KEGG   Simiduia agarivorans: M5M_13230Help
Entry
M5M_13230         CDS       T02281                                 

Definition
thioredoxin
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
saga  Simiduia agarivorans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    M5M_13230
Enzymes [BR:saga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     M5M_13230
Transfer RNA biogenesis [BR:saga03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    M5M_13230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2886146..2886988)
Genome map
AA seq 280 aa AA seqDB search
MSVFNSEQIQSLFQALEAIARDAGDAILAVYNAPESVAVDHKADQSPITQADLAAHDILV
AGLTPLLPGVPVLSEESHIPDYETRGQWHRYWLIDPLDGTKEFINRNGEFTVNIALIDEG
APVLGMVYVPVKNWLYYGANGHGSYRLRDGELATISTRKVDAALSQGEPITLVASRNHGA
DAVQSLMDKLSRATQRPVATDNMGSSLKLCLVADGSADLYPRLALTSEWDTAAAQAIVEA
AGGAVVDTDFRVLRYNQKADILNPFFYVIGDIGFPWQRYL
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagtattcaattccgaacaaatccagtcactttttcaggcattggaagccatcgcg
cgcgacgcaggcgatgccattctggctgtctacaatgccccggaatcagttgcggtggat
cataaggccgatcagtcacccattacccaggcggacctcgcagcgcacgatattctggtg
gcaggcctcacacccttgttgccgggcgtcccggtactgtcggaagaatcgcacattccc
gattacgaaacccgtggccaatggcaccgctactggctgatcgacccgctcgatggtacc
aaggaattcatcaatcgcaatggcgaattcacggtcaacattgccttgattgatgaaggg
gcgccggtactgggcatggtttatgtgccggtcaaaaactggctttactatggtgccaat
ggtcacggcagttaccgtttgcgcgacggcgaattggccactatcagcacccgcaaagtc
gacgcagcactttcacaaggtgagcctattaccctggtggcgtctcgcaaccatggcgcg
gacgctgtgcaaagcctgatggataaactcagtcgcgcaacccagcggccggtggccact
gacaacatgggctcgtcgctcaagctgtgcctggtggccgacggcagcgccgatctctac
ccgcgcctggcactcaccagcgagtgggataccgccgccgcacaggccattgtggaggcc
gcaggcggcgcggttgtcgacacggatttccgggtgctacggtacaatcaaaaggccgat
attctgaacccgttcttctatgtcatcggcgacataggcttcccgtggcaacgctacctc
taa

DBGET integrated database retrieval system