KEGG   Simiduia agarivorans: M5M_13555Help
Entry
M5M_13555         CDS       T02281                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
saga  Simiduia agarivorans
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    M5M_13555
   00670 One carbon pool by folate
    M5M_13555
Enzymes [BR:saga01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     M5M_13555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2960620..2961132
Genome map
AA seq 170 aa AA seqDB search
MSEVKLALIVAAAENGTIGRDNQLPWHLPGDLAFFKRCTLGKPIVMGRKTFDSIGRPLPG
RPNIVVTRQADWQAEGVTVCNSLEQALAVAGALPEAQSAGEVMVIGGAELYRQALPMAQR
LYLTRVHATIEGDAHFPAVEKSDWLLESDERHSAEGSNPYDYSFIVLSRT
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggtgaagctggcgttgattgtggcggcggccgaaaacggcaccattggccgc
gataatcaattgccctggcacctgcccggtgatctggcctttttcaaacgctgcaccctg
ggcaagcctattgtcatggggcgcaagacattcgattccatcggtcgccccctgcccggg
cggcccaatatcgtggtcacccgtcaggcggattggcaggcggagggtgttactgtctgt
aactcgctggaacaggcgttggccgtggcaggcgcactgcccgaagcacagtctgccggc
gaggtcatggtgattggtggtgctgagttgtaccgccaggccctgccaatggcccaacgt
ctgtatctgacacgggttcacgcgactattgaaggcgatgctcacttcccggcagtggag
aaatccgattggctgctagaatctgatgagcggcactcagccgaaggttccaatccgtac
gactattcgtttatagtgctatcccgtacgtga

DBGET integrated database retrieval system