KEGG   Simiduia agarivorans: M5M_13795Help
Entry
M5M_13795         CDS       T02281                                 

Definition
GTP cyclohydrolase I type 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
saga  Simiduia agarivorans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:saga00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3020381..3021016
Genome map
AA seq 211 aa AA seqDB search
MSPIAEQVRQALITRGLETPMVGNSLPPSQKREAIAGHVRGILTTLGLDLADDSLCETPE
RMAKLYVDELFAGLDYGQFPKISQIENKMGVSEMVRVQDISVISTCEHHLITIDGRAKVA
YIPGDKVLGLSKINRIVRFFAQRPQVQERLTQQILVALQTILGTEDVAVHMAATHYCVKA
RGVRDAESFTETQALAGAFKRDPGLRAEFLR
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccaatagcagagcaagtccggcaagcgcttatcacccgggggcttgaaaccccg
atggtgggtaacagcctgcctccaagccaaaagcgcgaagccatcgccggccatgtgcgc
ggtattctgaccacgttagggctggatcttgccgatgacagcctgtgtgaaacgcccgag
cgcatggcgaagctctacgtcgacgagttgtttgccgggctggattacggccagtttccg
aaaatctcccagatcgaaaataaaatgggtgtgtcggaaatggtgcgcgttcaggacatc
agcgtgatttccacctgcgaacaccacctgatcaccatcgatggtcgggccaaggtggcg
tatattcccggtgataaagtgctgggcctgtcgaaaatcaatcgcatcgtacggtttttt
gcccaacgcccacaggtgcaggaacgtttgacccagcagatcctggtggccttgcaaact
attctgggtacagaagatgtggccgtgcacatggctgcgacccactattgcgtgaaagcc
cgcggtgtgcgggatgccgagtcctttaccgagacccaggcactggccggcgcattcaag
cgcgacccgggactgagagcagaatttttacgttga

DBGET integrated database retrieval system