KEGG   Simiduia agarivorans: M5M_15040Help
Entry
M5M_15040         CDS       T02281                                 

Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
saga  Simiduia agarivorans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    M5M_15040
  Metabolism of other amino acids
   00480 Glutathione metabolism
    M5M_15040
Enzymes [BR:saga01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     M5M_15040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3270307..3270849
Genome map
AA seq 180 aa AA seqDB search
MNKILCSLVALALAGLSVSASAACPDFLNQEYRKLHSTAVESVCRDEAKAYLLVNTASHC
GFTPQFKGLEQLYQRFKDQGLVVVGFASDDFKQENKDEAKAADICYINYGVTFTMLAPTH
VRGDQANPTFKVLGAASSEPAWNFNKYLVSADGTRIQHFGSFVEPADKKLVAAISDELSQ
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
gtgaataaaattttgtgttcgttagtggcgcttgccttggcaggtctgagtgtgtcggca
tcggcggcctgcccggattttctcaatcaggaataccgtaaactgcacagcaccgctgtg
gagagcgtctgccgtgacgaggctaaagcctacttgttggtcaataccgccagtcattgc
gggtttaccccgcaattcaaggggctcgagcagctctaccagcgcttcaaggatcagggg
ctggtggtggtgggatttgccagtgacgacttcaagcaggaaaacaaagacgaagccaaa
gccgcggacatttgctacatcaattacggtgtgacctttaccatgctggcacccacccat
gtgcgcggagaccaggcgaatcctacgttcaaggtgttgggggcggcatcaagcgagccc
gcgtggaacttcaataaatacctggtcagtgcagacggtacccggatacagcattttggc
agttttgttgaacccgctgataaaaaattagtggcggcaatcagcgacgaattaagtcaa
taa

DBGET integrated database retrieval system