KEGG   Simiduia agarivorans: M5M_16565Help
Entry
M5M_16565         CDS       T02281                                 

Definition
galactose-1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
saga  Simiduia agarivorans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M5M_16565
   00052 Galactose metabolism
    M5M_16565
Enzymes [BR:saga01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     M5M_16565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3620618..3621583)
Genome map
AA seq 321 aa AA seqDB search
MSALKGVQLSRDQLALICVPHGARLRSMTFNGQPMVLSYSQDAQWLADIYAVNAICGRVA
NRIANASFEWRGQHYRLSKNLGDHCLHGGERNFSNQAWHLVDWSATHCQFHIVSEDGDQG
FPGRVEAWTDYRLEPDNRLHIHLKAKTNKPTPVDLTHHAYLTLGAGDCRELRLDLNADSV
LEKRSDIPTGQHIRLDKLKLDRAHNLGQQIERWRQADWSDRHGFDHFFPICGAEGEPIKA
ATLLSETVEMTLHTDQPGIFLYTAGHLGGHFAPFSGVCLEAQGYPNAVNEPRFPSPVLMP
GEIYQREIILQFSERVHAPTA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcactaaaaggcgttcaactttcacgcgaccaactcgcattgatttgtgtgccc
cacggcgcccgtctgcgctcaatgacgttcaacgggcagcccatggtgttgagctacagc
caggacgcacagtggctggcggatatctatgcggtcaacgccatttgcgggcgggtcgcc
aaccggattgccaacgcaagctttgaatggcgcgggcaacactaccgtctgtcgaagaac
ctgggcgaccattgtttgcatggtggtgagcggaatttcagcaatcaggcgtggcatttg
gtggattggtcagcgacgcactgccaatttcacatagtgtctgaggacggcgatcaaggc
tttcccggccgggtggaggcatggactgactatcgcctggaacccgataaccggttgcac
atccacctgaaggccaaaaccaataagcccacccccgtggatctgacccatcatgcctac
ctcactctgggcgcaggggattgccgtgaactgcgcctggatctcaatgccgactcagtg
ctggaaaagcgcagtgacattcccaccggacaacacatcagattggataaactcaaactg
gatcgggcgcacaatttaggacagcagattgagcgctggcggcaagcagactggtcggac
cgacacgggtttgatcatttctttcccatctgcggcgccgaaggagaacccatcaaggca
gccaccttgctgagcgagacggtggaaatgaccttgcacacggaccagccgggtatcttt
ctctacacagccggccatctgggcggccacttcgcccctttcagcggggtttgcctggaa
gcccagggctatccgaacgcggtgaatgaaccgcgctttccaagccctgtgctcatgccc
ggagaaatttaccaacgcgagattattctgcaattttctgaacgcgttcacgcaccaact
gcataa

DBGET integrated database retrieval system