KEGG   Simiduia agarivorans: M5M_16895Help
Entry
M5M_16895         CDS       T02281                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
saga  Simiduia agarivorans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:saga00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:saga00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:saga02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3713236..3715569)
Genome map
AA seq 777 aa AA seqDB search
MDIQKRQLLKMTVLGLGAAASPRLLQAMESTPTVDTDVLSLPHHSDTCHWLGPHFWGNRL
QDWRQHQGRLECLARGPDLEVRTVSWLTRTLTDANQPARLSMTLGQLEKGPGFAGFLLGV
GQGALDYRGAALAQRFAGKGGGLLAVINHQGQLSFRDFSDPEQPLEYERLSNGRQSQPTL
PARIKLDFYAEPRANQHFDLRLEARTESGQLLDFALLPDYPATRLVGGVSLVSSAPARKT
GGRWWFEQMAAGGAKLPAKPERELGPVMGCLYSLNQTVLKLSVQLMPVDLTRMNQVRLAF
RANATGSWTQGPVARIEDGFVALFRISDWQSEKNWQYRVKSMDGEALFTGTIAADPGDQR
KLNIALLSCIIPTSKSLDDEYYQPFIPQETLAGRYTPGNILFPHATLTRSLASHQPDLFL
FVGDQYYETFPTRYGRATPAAKLDTLYRWYLWYWSFRDLLRHKPCIVLADDHDVLQGNLW
GNAGESSEAPTEEQGGFKWDKSLVRMVYRIQHGHNPDSYDPTPIAHDIPPCYGNFVYGNV
NFAFVEDRKFKSPPDYVVPQQGRGELLGQRQEDFLRHWANTHPDLPRICITASMWGTPQT
GAEGEALVDYDANGYPPDGRTRAVQLLKDANALALAGDQHLGLVAIQGVETFDDGPVFFT
GPAAAAFWQRWFEGNNRLPNQRGGNPDTGDFIDSCGNKMRVLAVANPKISFDEFVAQKKG
WGMFLADRSLTSEGYGLVTVDHQSNEFVLHCYPTASGKGAQQYPGWPCAFPIKRQST
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atggatattcagaaacgacagctgctgaaaatgaccgtactggggttgggtgctgccgcc
agcccccgcctgctgcaggccatggaaagcacccccacggtagataccgatgtgctgagc
ctgccccatcactccgacacctgccactggcttggaccgcacttctggggcaaccggctt
caggattggcgccaacaccagggccggctcgagtgcctggcacgcggccctgatcttgaa
gtccgcacagtctcctggctgacccgcacgctcaccgatgcaaaccaacccgccagactc
agcatgaccttggggcaattggaaaaggggccgggattcgctggttttttgctcggcgta
ggtcagggcgcgctcgattaccgcggcgccgcgttggcgcaacgatttgccggcaaaggc
ggtggcctgttggcggtaattaatcatcaggggcaactcagcttccgcgatttcagcgat
ccggagcaaccgcttgaatacgaacgattgagtaacggccgccaatctcagccaacactg
ccagcccggattaaactggatttctacgccgagccgcgcgcgaaccagcacttcgatttg
cgattggaagcccgcacagaatcgggccagttgttggactttgcattgttacccgattat
cccgctacccgacttgtgggcggcgtgtcactggtatcgtcagcgcccgcacgcaaaacc
ggcggccgttggtggtttgagcagatggccgcaggcggcgccaaactgccggcaaagccc
gaacgagaactgggcccggtgatggggtgtttgtattcgctcaatcaaacggtattgaaa
ctgagcgtgcagctgatgcctgttgatcttacacgcatgaatcaggtgcgcctggcgttc
cgcgccaacgccacaggcagttggactcagggtccggtagcccggattgaagacggtttt
gttgcactgttcagaatctctgactggcaaagtgaaaaaaactggcagtaccgggtcaag
tccatggacggtgaagcacttttcactggcaccatcgccgctgatcccggcgaccagcgc
aagctgaatatcgcactgctgagctgcattattcccaccagcaaaagccttgacgacgaa
tactaccaaccctttattccacaagaaaccttggccggccgctacacgccgggcaatatt
ctttttcctcacgcaacactcactcgctcactggccagtcaccagcccgatttgtttttg
tttgtgggtgatcaatattacgaaacctttcccacccgttacggtcgtgcaacgcccgcg
gcaaaactagatacgctgtatcgctggtatctttggtactggagcttccgcgatctgctg
cgccacaaaccttgtatcgttctggccgacgaccatgatgtattgcaaggcaatctctgg
ggcaatgccggcgaaagcagcgaagctcccacagaagaacagggtggttttaaatgggac
aagtcactggtgcgcatggtgtatcggatacagcatggccacaacccggacagttacgat
cccacacccatcgcccatgacatccccccctgctacggcaactttgtgtacggcaatgtg
aattttgcgtttgttgaggaccgcaagttcaaatcgccacccgactatgtggtgccgcag
caagggcgtggcgaactcctgggccagcgtcaggaagattttctccggcactgggccaac
acacacccagacctgccgcgcatatgcattaccgcctctatgtggggtacaccgcaaacc
ggcgccgaaggtgaagcgctggtggactacgatgccaacggttatccgcccgatggccgc
acccgggcggtgcagcttttaaaagatgccaatgcgctcgcgctcgccggcgatcaacac
ctgggtctggtagccatccaaggcgttgaaacgtttgacgatggcccggtattttttact
ggtcccgccgcagcggccttctggcaacgttggtttgaaggcaataaccggctccccaac
cagcgcggaggcaaccctgataccggcgacttcatcgacagctgcggtaataaaatgcgg
gtactcgcggtcgccaacccgaaaatatcctttgatgagttcgtggcgcagaaaaaaggc
tggggcatgtttctcgcagaccgctcactcaccagcgaaggctatggcctggtcactgtc
gatcatcagagcaacgagtttgtattgcactgctaccctactgcatcaggcaaaggcgca
cagcaatacccgggctggccctgtgcttttcccatcaagcggcaatcaacctag

DBGET integrated database retrieval system