KEGG   Simiduia agarivorans: M5M_17595Help
Entry
M5M_17595         CDS       T02281                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
saga  Simiduia agarivorans
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    M5M_17595 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    M5M_17595 (murA)
Enzymes [BR:saga01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     M5M_17595 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3876831..3878096
Genome map
AA seq 421 aa AA seqDB search
MDKLLIQGGARLNGEIRISGAKNSGLPILAATLLAEGPMHVCNLPHLNDITTMLALLRCM
GADITIDEKMCVEINACGIEDYTAPYELVKTMRASILVLGPMLARFGEANVSFPGGCAIG
SRPVDIHLRGLEAMGAEIEVDQGYIRARSNGRLKGAHFFMDTVTVGGTENLVMAAALAEG
RTVLENAAREPEVVDLCDCLVAMGAKISGIGTATLTIDGVESLKGCTYRVMPDRIETGTY
LVAAAATGGKVKLKDTRADILEAVILKLEEAGAEITCGEDWIELDMKGKRPKAVNLKTAP
YPAFPTDMQAQFTAMNAVAEGVGTVIETIFENRLIQVHELNRMGANIALDGNRAMITGVP
KLKAAPVMASDLRASASLVIAGLVAEGDTLVDRIYHIDRGYECIEEKLLMLGANIRRVTA
K
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggacaagctattgatccagggcggcgcccgtttaaacggagagatccgcatttcaggc
gcaaaaaattccggtttgcccattctggcggccacgctgctggcggaagggccaatgcat
gtgtgcaatctgccccatctcaacgacattaccaccatgttggcgttattgcggtgtatg
ggtgcagatatcaccatcgacgagaagatgtgcgtggaaatcaatgcttgtggcattgag
gattacactgcgccctacgagctggtgaaaaccatgcgcgcgtccatcctggtgcttggc
cctatgttggcacgcttcggcgaggccaatgtgtcatttcccggcggctgtgccattggc
agccggccagtggatatccacctgcgcgggctcgaagccatgggtgctgagatcgaggtg
gatcagggttacatccgcgcccgcagtaacggccgactcaaaggcgcacactttttcatg
gacacggtcaccgtcggcggcacggaaaatctggtgatggcggcggcgctggccgagggc
cgcaccgtgctggaaaacgccgcgcgtgagcctgaggtggttgacctgtgtgattgtctg
gtggccatgggtgcaaaaatttccggtatcggcaccgccaccctcaccatcgatggtgtg
gagtcactcaagggatgtacctaccgggtcatgcctgatcgcatcgaaaccggcacttat
ctggtggccgcggccgcaaccggcggcaaagtgaagctcaaagatacgcgcgcggatatt
ctcgaagcggtgattctcaaactggaagaagccggtgctgaaatcacctgtggcgaagac
tggatcgagctggacatgaagggcaaacggcccaaggcggttaatctcaaaaccgcgcca
tacccggcgtttcccaccgatatgcaagcccagttcaccgccatgaatgcggtggccgag
ggggtgggtaccgtcattgagactatttttgaaaaccgcctgatccaggtgcatgaactg
aaccgcatgggagccaatatcgccctggatggcaaccgcgccatgattaccggggtgccg
aagttgaaggcggcgccggtgatggcgagtgatctgcgggcgtccgccagtctggtgatt
gccgggttggtcgccgagggcgatacactggtagaccggatttaccacatcgaccgcggt
tatgaatgtattgaagaaaagctcctgatgctgggcgccaacattcgccgggtgaccgcc
aaatga

DBGET integrated database retrieval system