KEGG   Simiduia agarivorans: M5M_17605Help
Entry
M5M_17605         CDS       T02281                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
saga  Simiduia agarivorans
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:saga01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:saga00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3878719..3880017
Genome map
AA seq 432 aa AA seqDB search
MIRRLNSNDPGFERALADLLAFETISDRLVAERVDTILQSVKADGDAALLKYSAEFDRLE
VERVADLEVSKAELAAAHDRIEPAAREALTLAAARVRRYHEHQLAQSWSYTEADGTLLGQ
QVTAMERVGVYVPGGKASYPSSVLMNTIPAKVAGVDDVVMVVPAPGGELNPLVLAAAHIA
GVDRVFKLGGAQAVAALAFGTETLPKVDKIVGPGNIYVATAKRAVFGTVAIDMIAGPSEI
LVVCDGKTDPDWLAMDLFSQAEHDELAQAIFIGWDAAFIDQVQAAMARLLPTLERAAIAG
TALADRGALIQVRDQAEAIDLINRIAPEHLELSVEDPQAWLPSIRHAGAIFMGRHTAEAL
GDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLIMCSPAGASSLGKCASVLARGESLEA
HARSAEYRIRED
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgatccggcgactgaatagcaatgatccgggtttcgagcgcgcgctggctgatttactg
gcgttcgaaaccatcagcgaccggctggtggctgaacgggtggataccatcctgcaatca
gtgaaggccgacggcgatgccgccctgctgaaatactccgccgagtttgatcggttggaa
gtggagcgggttgccgacctcgaagtgtcaaaagccgaactggctgccgcccacgaccgt
attgagccggccgcacgcgaggcgctcactctggccgccgcgcgcgtgcgtcgctaccac
gaacaccagttggcgcaatcctggtcctataccgaagccgatggcaccttgctcggtcag
caggtgaccgcgatggagcgggtgggcgtatatgtgcccggcggcaaggcgtcttatccc
tcatcggtgttgatgaataccattccggccaaggtggctggcgtggatgacgttgtcatg
gtggtgcctgcgcctggcggtgagttgaacccgttggtattggcggcagcgcacattgcc
ggtgtggatcgcgtattcaaactgggcggcgcgcaagcggtggcagcgctggccttcggg
actgaaaccctgcccaaagtggataaaattgtcggccccggcaacatttatgtggccact
gccaaacgcgcggtgtttggcaccgtcgctatcgatatgattgctggcccgtcggaaatc
ctcgtggtttgcgatggcaaaaccgatcccgattggctggcgatggacttgttcagtcag
gcggagcacgatgaattggcgcaggccatatttatcggttgggatgcggcgtttatcgat
caggtgcaggctgccatggcgcggttattgccaacgcttgagcgtgcggccattgccggt
actgctttggctgatcgcggtgcgctgattcaggtgcgcgatcaggcggaagccattgac
cttatcaaccgcatcgcgccggagcacctggagctgtccgttgaggacccgcaagcctgg
ttgccgtccatccggcatgcgggggctatttttatggggcgccacacggccgaagcgctg
ggcgactattgtgctggccccaatcacgtgctgcccacctcgggcaccgcgcgcttttct
tcgccattgggggtgtatgacttccagaagcgcagctcgctgattatgtgctcgcctgcc
ggcgccagtagcctgggtaagtgcgccagtgtgctggcgcgtggcgagtccctggaggcc
cacgcccgatctgccgaataccggatacgtgaagactga

DBGET integrated database retrieval system