KEGG   Simiduia agarivorans: M5M_18125Help
Entry
M5M_18125         CDS       T02281                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
saga  Simiduia agarivorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:saga00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    M5M_18125
DNA repair and recombination proteins [BR:saga03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      M5M_18125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3989417..3990010
Genome map
AA seq 197 aa AA seqDB search
MFSPLIDELMSALRALPGVGPKSAQRMALHLLERDREGASRLATALATAVEGVGECDRCR
TLTEQTLCSICANKRRNQALLCVVETPADVLAIEQAGTYQGTYFVLHGHLSPIDGIGPQD
LGLDQLHSLLAAGGIEEVILATNPTIEGEATAHYISERAKKLDVPVSRIAHGVPLGGELE
YIDGGTLAHAFSSRQRV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgttcagccctttaattgatgaattgatgagtgccttgcgtgcactgcccggtgttggc
cccaaatcggcccagcgcatggcgttgcatttgctcgagcgcgaccgggaaggcgccagc
cggttggccacggcactggccaccgccgtggaaggcgtgggtgagtgcgatcgttgccgc
accctgaccgagcaaaccctgtgttccatctgcgccaacaaacggcgcaatcaggcgctg
ctttgtgtggtggaaacgccagccgacgtgctggccattgagcaggccggcacctaccag
ggcacctattttgtgttgcatggtcacttgtctcccatcgacggcatcgggccgcaggat
ctgggtttggaccaactgcatagcttgctggccgccggcggcatagaagaagtgattctc
gccaccaaccccaccattgaaggcgaagccacggcccattacatcagcgagcgggcgaaa
aaactcgacgttccagtatcgcgcattgcccacggcgtgcctttgggcggtgaacttgaa
tacattgacggcggcaccctggcgcacgccttctccagccgacagagggtgtga

DBGET integrated database retrieval system