KEGG   Simiduia agarivorans: M5M_18885Help
Entry
M5M_18885         CDS       T02281                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
saga  Simiduia agarivorans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    M5M_18885
Enzymes [BR:saga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     M5M_18885
Exosome [BR:saga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M5M_18885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4156131..4157627)
Genome map
AA seq 498 aa AA seqDB search
MSPDTASPLILAIDQGTTSSRAVLFDQQLRAINQAQEAFAQAYPNPGWVEQDAMDIWHTV
LNCCRQLLTPDTLHRVKAIGITNQRETTIVWDRQTGEPIAPAIVWQDRRTHAFCAALRAQ
KRDALIREKTGLPIDPYFSGSKIRWLLDTVPDARARAERGELAFGTVDCWLLWQLTGGQR
HATDATNASRTQLFNIHTQTWDKDLLELFDIPAAMLPQVLDSAADFGHTDPALLGVSVPV
LGVAGDQQAATIGQQCLAAGQAKCTFGTGAFLMLNTGNRAVTSDNRLLTTLAYRLDNQVH
YALEGSVFIAGSAVQWLRDGLKIINRSADTEALVQSIKSDHGVMMVPAFTGLGAPHWRAD
ARAAIFGMELSTGPAQLAYACLQSIALQVFDLLQAIKADGQRMDVLKIDGGMTANEWFVE
QLAWITQTPLFRPDWQESTVLGAARLAAHQLGWCDLSDTGSPANPGTQFAPAAAGADRDQ
LLARWQAAIAATLVFAEG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagcccagacacagcctcacccctgatattggccatcgaccagggcaccaccagttcg
cgggcggtattgtttgaccagcagttgcgcgccatcaaccaggcccaggaagcctttgcc
caagcctaccccaacccgggctgggtggagcaggatgccatggacatctggcataccgtg
ttgaactgttgccgccagttactgacacccgacaccctgcaccgggtaaaagccattggc
attaccaatcaacgggaaaccaccatcgtctgggacaggcaaaccggcgagcccattgcc
ccggccattgtctggcaggaccggcgcacgcacgcattctgtgcggcgcttcgcgcacaa
aaacgcgatgcgctcatcagagaaaaaaccggcctgcccatcgacccttatttttccggc
tccaaaatccgctggctgttggacacggttcccgacgctcgcgcgcgcgccgagcgcggc
gaactggcctttggcaccgtggattgctggttgctctggcagctgaccggcggccagcgc
catgccaccgatgccaccaatgccagccgcacgcaactgttcaatattcacacccagacg
tgggataaagatctgctcgaactgtttgatattcccgccgcaatgctgccccaggttttg
gatagtgccgccgacttcggtcacaccgacccggccctgttgggcgtatcggtgcctgtt
ctgggcgtggccggcgaccagcaggccgccactattggccagcaatgcctcgctgccggc
caggccaagtgtacctttggtaccggcgcgtttttgatgctcaatactggcaacagggcc
gtcacgtcggataaccgcctgctcaccaccctcgcctaccggctggataaccaagtgcac
tacgcactggaaggttcggtgtttattgccggctcagcggtacagtggttgcgggatggt
ttgaaaatcattaatcgctccgccgataccgaagcgctggtgcaatcgatcaagtcagat
catggcgtgatgatggtgcccgcctttaccgggctgggcgcaccgcactggcgcgccgat
gcccgcgcggcaatttttggcatggaactgagtacgggcccggcacaactggcttatgcc
tgcctgcaatccattgcactgcaggtgtttgatctgttgcaggcgatcaaggcggatggt
caacgcatggacgtattaaaaatcgacggcggcatgacggccaatgagtggtttgtcgag
cagctggcgtggattacccaaactccgctgttccggccagactggcaggaatccaccgtc
ttgggcgcggcccgtcttgctgcccatcaactgggttggtgcgatttgtcggacaccggc
tctcccgccaacccgggaacccaatttgcgcccgccgcagccggtgcagaccgggatcaa
ttgctggctcgctggcaggccgcaattgcggccacgctggtatttgccgagggataa

DBGET integrated database retrieval system