KEGG   Simiduia agarivorans: M5M_19090Help
Entry
M5M_19090         CDS       T02281                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
saga  Simiduia agarivorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:saga00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    M5M_19090
Enzymes [BR:saga01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     M5M_19090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4202031..4202651
Genome map
AA seq 206 aa AA seqDB search
MIGRITGTLVEKQAPTLIVDVQGVGYEVQVPMTSIYQLPDTGKQVLLHTHFAVSETAQQL
FGFATRADRDLFRTLIKVNGVGPKMALAILSGMEGKVLARCVAEDNVAALVKVPGVGKKT
AERLLIELRDKLPALGVDVSPLAAMEQASGGVPSLSERDDAEAALVALGYKPTDATKAIT
AAVKQAPEAKSQELIRLALKAMIPAG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgatcggacgaatcaccggaaccctggtcgagaagcaggcgcccaccctcattgtggac
gttcagggtgtgggctacgaagtacaggtgcccatgaccagcatttaccagttacccgac
accggtaaacaggtgttattgcacacgcactttgcagtgtcggaaacggcgcaacaatta
ttcggctttgctacccgggccgatcgcgacctgttccgcacgctgatcaaggtcaatggc
gtgggccccaaaatggcgttggcgattttatcgggcatggaaggcaaagtactggcccgt
tgcgtggcggaagacaatgtggccgcgctggtaaaagtaccgggcgtcggcaagaaaacc
gccgagcgcttactgattgagttgcgcgacaaactgcccgccctgggcgtggatgtatcg
ccgctggcggcgatggagcaggccagtggtggggtgccgtctttatccgaacgcgacgat
gcggaagcggcgctggtagcgctgggttataaacccaccgacgccaccaaggcgatcact
gccgctgtcaaacaagcacccgaggccaagagtcaggagctgatccgtctggcgctcaaa
gcgatgatcccggcaggataa

DBGET integrated database retrieval system