KEGG   Simiduia agarivorans: M5M_19490Help
Entry
M5M_19490         CDS       T02281                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
saga  Simiduia agarivorans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:saga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    M5M_19490 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    M5M_19490 (glk)
   00052 Galactose metabolism
    M5M_19490 (glk)
   00500 Starch and sucrose metabolism
    M5M_19490 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    M5M_19490 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    M5M_19490 (glk)
   00524 Butirosin and neomycin biosynthesis
    M5M_19490 (glk)
Enzymes [BR:saga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     M5M_19490 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4286817..4287815
Genome map
AA seq 332 aa AA seqDB search
MSVAALNSAPQLFPYVVADIGGTNARWGLVTGLDSNGRYLIESIRTFENRHHPQFRDSLA
AYLDALGGIEIKRVCVALAGPVLGDLINMTNINWSFSVRETEAAFGLDKLLIVNDFTALA
YATSALGQADLVCIKQGIQKSAAPRAILGPGTGLGMASLIPVSERWIPVCGEGGHTAFAP
RGDEEIALCQVMQKNEGYISKEALLSGSGLERIYRSLAEVRHLNVEPMAASKISGLAVSN
ADKLAVDALNIFCAVLGSAAADQALTVGALGGVYLGGGILPRVQEFLKKSPFEARFKEKG
VMSHYMNDIPVYLIVADEPALIGAAALLAEQQ
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtggctgcactcaacagcgccccgcagttgtttccctatgtggtggccgatatc
ggtggcaccaatgcccgttggggactggtgaccgggctcgactcgaacggtcgttacctg
attgaatcgattcgcaccttcgaaaaccgtcatcacccgcaattccgtgactctttggcg
gcttatctggatgccctgggcggtatcgagatcaagcgcgtatgcgtcgccctggcgggt
cccgtgctgggtgacctgatcaatatgaccaacatcaattggtctttctccgtgcgcgaa
acggaggccgcatttggcctggataaactgctgatcgtgaatgattttacggcattggct
tatgccaccagcgcactgggtcaggcggacctggtgtgtattaagcagggcatccagaaa
tccgctgccccgcgtgcgattctcggtcccggcacaggtcttggcatggcttcgcttatt
ccggtgagcgagcgctggattccggtctgtggtgaaggtggccatacggcatttgcgccg
cggggggatgaagagatcgccttgtgtcaggtgatgcaaaaaaacgaaggctacatatca
aaagaagcgttgctttcaggttcaggtttggaacgaatttaccgcagcctcgcagaagtt
cgtcatctgaacgtagaaccgatggcagcgtcaaaaatatccgggctggcggtcagcaat
gctgacaagctggctgtggatgcgctgaatattttctgcgcggtactgggctcggcagca
gccgatcaagccctgaccgttggcgctttgggtggcgtctacctggggggcggaattttg
cccagagtgcaggaatttttaaagaaaagcccgtttgaagcccggtttaaagaaaaaggc
gtgatgtctcattatatgaatgacattccggtttatctgattgtggcggatgagcctgcg
ctgattggcgcggcggcgttgctcgcagagcaacagtaa

DBGET integrated database retrieval system